BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b05 (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 1.9 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 5.7 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 339 RCPAGDPGQSERSVLGSVPDTLAP 410 RCP+G+ SER+ L TL+P Sbjct: 97 RCPSGESMLSERAALLRGVPTLSP 120 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.4 bits (48), Expect = 1.9 Identities = 26/92 (28%), Positives = 39/92 (42%), Gaps = 1/92 (1%) Frame = +3 Query: 441 DRPIR*NPVLGR-RLRGHLEGYGAARQRGSGQEHRSLQLQLEAAGEVAAARDCQAGRQSG 617 ++P + GR R R HL + G + R+ + AAG+ AAAR +G Sbjct: 244 EKPFECDKCRGRFRRRHHLVHHKCG---GEEEAERAPAPAVRAAGDAAAARGAARADGAG 300 Query: 618 GMSSLPQPETPQGVL*GSRREDHSVLSPRLAG 713 G +P Q +R +V P+LAG Sbjct: 301 GPLHDHRPALAQ------QRRVAAVQVPQLAG 326 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 716 LSGEPRGEYAVIFTPRASQ 660 L GE RG++ V TP S+ Sbjct: 212 LEGERRGKFTVPLTPVVSE 230 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 412 PGASVSGTDPSTERSDCPGSPAGHRAPSPGDETCSTVSKL 293 PG + G + S G PAG++ + T T ++L Sbjct: 42 PGLGLHGLPVDSLHSSMAGYPAGNQRKQRRERTTFTRAQL 81 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,694 Number of Sequences: 336 Number of extensions: 3605 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -