BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b05 (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.77 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 26 1.3 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 26 1.3 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 1.3 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 25 1.8 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 25 2.3 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 2.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 3.1 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 7.2 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 9.5 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 23 9.5 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 9.5 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.77 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 407 PRPTRKTALSSRPTNQVKSSSRTSITWTP-GRLWSRSSKRVWSRASESPTSTRSS 568 PR R A+ +R T ++ S P +WSR S + A + STRSS Sbjct: 37 PRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPARTASCSTRSS 91 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 160 PASPRLASTSRFPILISDI 104 P+SPRLA S P+ S I Sbjct: 51 PSSPRLAQASTCPVPCSSI 69 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 25.8 bits (54), Expect = 1.3 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +2 Query: 404 GPRPTRKTALSSRPTNQVKSSSRTSITWTPGRLWSRSSKRVWSRASESPTSTRSS 568 G + T LS+ ++++ R++ +PG + ++ R ++ PT TRSS Sbjct: 415 GTTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIVYYPARETLPRLAQPPTITRSS 469 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 25.8 bits (54), Expect = 1.3 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = +2 Query: 401 TGPRPTRKTALSSRPTNQVKSSSRTSITWTPGRLWSRSSKRVWSRASESPTSTRSSWRGC 580 +G R + SR ++ +S SR+ G SRS R S S S + +RS + Sbjct: 1083 SGSRAGSRAGSGSRSRSRSRSRSRSRSGSAKG---SRSRSRSGSGGSRSRSRSRSRSQSA 1139 Query: 581 CSTRLSSRSSIR 616 S + SRS R Sbjct: 1140 GSRKSGSRSRSR 1151 Score = 23.8 bits (49), Expect = 5.4 Identities = 20/64 (31%), Positives = 32/64 (50%) Frame = +2 Query: 416 TRKTALSSRPTNQVKSSSRTSITWTPGRLWSRSSKRVWSRASESPTSTRSSWRGCCSTRL 595 +R + SR ++ +S S+++ + G SRS R S+AS +RS R +R Sbjct: 1119 SRSGSGGSRSRSRSRSRSQSAGSRKSG---SRSRSRSGSQASRGSRRSRSRSRSRSGSRS 1175 Query: 596 SSRS 607 SRS Sbjct: 1176 RSRS 1179 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 445 RSGRESRLPCRPGASVSGTDPSTERSDCPGSPAGHRAP 332 R+G +S P G + SG D T+ D P + A +P Sbjct: 559 RTGPKSLAPDHEGDNDSGVDEYTQEKDRPNALASPASP 596 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +1 Query: 484 VDTWKAMEPLVKE 522 +D WKA+EPL KE Sbjct: 134 LDAWKALEPLQKE 146 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 25.0 bits (52), Expect = 2.3 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +1 Query: 220 NEKEVGEAITSKIKEGV--VTREDLFITSKLWNTFHR-PDLVRGALQETLDNLNV 375 N E+G S++ E V V + +T + T+H P+L +G L + + NLNV Sbjct: 3 NFVEMGPYTLSEVHERVNLVWNANNTVTYEQRRTWHFVPELSKGTLDDQVTNLNV 57 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.0 bits (52), Expect = 2.3 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -2 Query: 436 RESRLPCRPGASVSGTDPSTERSDCPGSPAGHRAPSPGDETCST 305 R RL G +++ D ER+D P+G R + +E +T Sbjct: 1159 RNRRLLGMSGQAINNDDDGRERADLAAGPSGMRNRAIDEENEAT 1202 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 173 ASLTACVTSPGFDFQVPNPNIG 108 A L+ V PG +F +P+P IG Sbjct: 1745 AHLSFKVPPPGIEFTLPSPKIG 1766 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 684 DLHAASLTELLEAFLVEVRMTFHLID 607 D+HA +TEL F +E ++ ID Sbjct: 575 DIHANKITELGNYFEIESQLALSTID 600 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 409 GASVSGTDPSTERSDCPGSPAG 344 G+ S T+ E S CP PAG Sbjct: 237 GSPTSATNGVGEESGCPTIPAG 258 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 409 GASVSGTDPSTERSDCPGSPAGHRAPSPGDETCST 305 GA SG+ + C GS A R G C T Sbjct: 415 GAGSSGSSNGSNGGGCNGSGADQRTHYCGGAGCET 449 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 510 ARQRGSGQEHRSLQLQLEAAGEVAAARDC 596 A +G GQEH+ AG R+C Sbjct: 18 AIDQGHGQEHKPCTTPNGTAGRCVRVREC 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,576 Number of Sequences: 2352 Number of extensions: 15951 Number of successful extensions: 54 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -