BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b01 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 27 0.21 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.1 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 23 3.3 X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 21 7.7 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 21 7.7 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.7 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 26.6 bits (56), Expect = 0.21 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 188 CVMLHSSSPPPFRHSAQP 135 C L SS PPP++ SAQP Sbjct: 323 CWSLTSSPPPPYQISAQP 340 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 578 TELPPTHPIRLGLALNFSVFYYEILNSPDR 667 T+ P HP+R+ ++FS Y+ + + D+ Sbjct: 372 TDGEPVHPVRVNTIISFSGERYDFVINADQ 401 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +2 Query: 578 TELPPTHPIRLGLALNFSVFYYEILNSPDR 667 T+ P HP+R+ ++FS Y+ + + D+ Sbjct: 372 TDGEPVHPVRVNTIISFSGERYDFVINADQ 401 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 Query: 421 HPQLTDRRIKSFLLQNEGRLPPVPG 495 HP T R + SF N + PP G Sbjct: 334 HPYGTTRLMSSFAFDNNDQGPPQDG 358 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 421 HPQLTDRRIKSFLLQNEGRLPP 486 HP T R + SF N + PP Sbjct: 333 HPYGTTRLMSSFAFDNNDQGPP 354 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +1 Query: 421 HPQLTDRRIKSFLLQNEGRLPP 486 HP T R + SF N + PP Sbjct: 334 HPYGTTRLMSSFAFDNNDQGPP 355 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 352 PQPG*EGAP*HLL*HPRCPRQVPHPQLTD 438 P PG P HL HP P +L D Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGPKQELPD 260 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.7 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 352 PQPG*EGAP*HLL*HPRCPRQVPHPQLTD 438 P PG P HL HP P +L D Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGPKQELPD 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,478 Number of Sequences: 336 Number of extensions: 2671 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -