BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a20 (621 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0646 + 18363847-18364858,18365501-18365578,18366161-18366798 28 5.2 03_01_0469 - 3613062-3613745,3613952-3614512,3614600-3614690,361... 27 9.1 >04_03_0646 + 18363847-18364858,18365501-18365578,18366161-18366798 Length = 575 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 106 ERINKRISSTSLSYDSGDEANDTRVPYEQKSDEGNILDEIFTIV 237 ER+ + T S+ DE +T YE +E +++DE+ IV Sbjct: 323 ERLKEIEKLTLTSWKETDEIENTNEEYESTDEELDLIDELAEIV 366 >03_01_0469 - 3613062-3613745,3613952-3614512,3614600-3614690, 3614782-3614870,3614962-3615027,3615309-3615423, 3615521-3615966 Length = 683 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 3 YWKENIDLIEHNGRNIRYYYLHAL 74 +W E ID G N+ YYY H L Sbjct: 205 HWLEAIDPRHRYGHNLHYYYQHWL 228 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,662,006 Number of Sequences: 37544 Number of extensions: 271046 Number of successful extensions: 734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 734 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1502076244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -