BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a19 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 4.6 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 6.1 AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 22 6.1 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 22 6.1 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 22 6.1 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/30 (23%), Positives = 19/30 (63%) Frame = +1 Query: 337 NDLHKQEVLAAEPVIRHHCRCMQQCKQATP 426 ++++ E+LA+E +++++ C+ TP Sbjct: 24 DNINVDEILASERLLKNYFNCIMDRGACTP 53 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 447 YGLRLQNWCCLFTLLHTATVMSDHWFSCK 361 Y L+L N +FT + + +H+FS K Sbjct: 324 YSLQLINHRVVFTAMGLYVLNMEHFFSVK 352 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -1 Query: 546 LLNSMRYCISFRLYFCSCS 490 LL YC+ FC CS Sbjct: 285 LLVDSTYCLFLLFVFCDCS 303 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -1 Query: 546 LLNSMRYCISFRLYFCSCS 490 LL YC+ FC CS Sbjct: 285 LLVDSTYCLFLLFVFCDCS 303 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -1 Query: 546 LLNSMRYCISFRLYFCSCS 490 LL YC+ FC CS Sbjct: 285 LLVDSTYCLFLLFVFCDCS 303 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,443 Number of Sequences: 336 Number of extensions: 3116 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -