BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a19 (759 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizos... 27 3.8 SPAC694.06c |mrc1||mediator of replication checkpoint 1 |Schizos... 26 6.7 SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomy... 25 8.9 SPBP16F5.08c |||flavin dependent monooxygenase |Schizosaccharomy... 25 8.9 >SPAC631.01c |acp2||F-actin capping protein beta subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 268 Score = 26.6 bits (56), Expect = 3.8 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 571 ANDSSQQLANVAQMVEKVETKM 636 A D ++ANV ++VE++ET+M Sbjct: 203 AADDDTEIANVGKLVEEMETRM 224 >SPAC694.06c |mrc1||mediator of replication checkpoint 1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1019 Score = 25.8 bits (54), Expect = 6.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +1 Query: 199 VTANLLSAAQAINNATAGHEKLHEAMQMASELNNYSDPNFVEN 327 +++N +S A +T G+ + + +SE+ +SD NF+ N Sbjct: 48 LSSNAVSEASLDKESTVGNLENQKNRSYSSEIYLHSDTNFLSN 90 >SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.4 bits (53), Expect = 8.9 Identities = 11/47 (23%), Positives = 27/47 (57%) Frame = +1 Query: 217 SAAQAINNATAGHEKLHEAMQMASELNNYSDPNFVENLQKNDLHKQE 357 S +Q +++ HE++HE+ + +E+ S E+ +++ L+ +E Sbjct: 143 SQSQNVDSGKTNHEEIHESRHLQTEIEEPS--GLEESSEESVLYSEE 187 >SPBP16F5.08c |||flavin dependent monooxygenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 447 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 Query: 409 CKQATPVLESE 441 CKQATPVLE E Sbjct: 406 CKQATPVLEEE 416 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,759,900 Number of Sequences: 5004 Number of extensions: 50470 Number of successful extensions: 151 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -