BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a18 (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.3 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.4 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 9.4 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 9.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 430 YLAAIDSVQTTVADGKKDYNLEENVITWTDYLY 528 +L+ I+ V T++A NL EN I W DY + Sbjct: 537 FLSDINGVFTSIASLLL-LNLSENHIEWFDYAF 568 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -2 Query: 573 LILIYYIHSSRMKTRIQVICPSDYILFKIVIFLSISY 463 L +I++IH + + + Y++ VIF++I+Y Sbjct: 122 LPVIFWIHGGAFQFGSGIPMGAKYLMDSDVIFVTINY 158 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = -2 Query: 573 LILIYYIHSSRMKTRIQVICPSDYILFKIVIFLSISY 463 L +I++IH + + + Y++ VIF++I+Y Sbjct: 122 LPVIFWIHGGAFQFGSGIPMGAKYLMDSDVIFVTINY 158 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 592 AFDIYPTGRGVWKSD 636 A +PTGRG++ +D Sbjct: 183 AXRFWPTGRGIYHND 197 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 271 NEVTYTPRLLIADLK 315 N V + PR++I DLK Sbjct: 137 NTVIHQPRIIIIDLK 151 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,610 Number of Sequences: 438 Number of extensions: 4760 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -