BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a17 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 1.2 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.2 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.2 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 24 1.6 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 24 1.6 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 24 1.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.7 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 4.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.3 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 116 QPESLHLVVLYQEKKR 69 QPE+LHL+V Y +K + Sbjct: 167 QPEALHLLVDYMKKNK 182 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 116 QPESLHLVVLYQEKKR 69 QPE+LHL+V Y +K + Sbjct: 481 QPEALHLLVDYMKKNK 496 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 116 QPESLHLVVLYQEKKR 69 QPE+LHL+V Y +K + Sbjct: 714 QPEALHLLVDYMKKNK 729 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 116 QPESLHLVVLYQEKKR 69 QPE+LHL+V Y +K + Sbjct: 714 QPEALHLLVDYMKKNK 729 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 190 TAILTLWSSVFFFATT*QSSIRKQTSRRVFILLFYIRKKNDLMIFLKL 47 TAI L+ FF S +R + ++VF ++ +N L++ + L Sbjct: 18 TAIHPLFYVCTFFGLAPYSLVRVENGKKVFKFAWWPLTRNALLVLILL 65 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 190 TAILTLWSSVFFFATT*QSSIRKQTSRRVFILLFYIRKKNDLMIFLKL 47 TAI L+ FF S +R + ++VF ++ +N L++ + L Sbjct: 18 TAIHPLFYVCTFFGLAPYSLVRVENGKKVFKFAWWPLTRNALLVLILL 65 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +3 Query: 603 LAFVPTVIINEKYDKDVETQAFENLKAVV 689 L++VP + N++ + VET F+++ + V Sbjct: 353 LSYVPREVYNKEISRLVETLKFQSITSAV 381 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -2 Query: 149 HDITEQHQKANQPESLHLVVLYQEKKRFNDFFETPAH 39 H + EQH + +QP ++Y ++ N + P H Sbjct: 169 HHMQEQHPQHHQPHHQQQHMMYGGQQGANMHQQGPPH 205 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -2 Query: 149 HDITEQHQKANQPESLHLVVLYQEKKRFNDFFETPAH 39 H + EQH + +QP ++Y ++ N + P H Sbjct: 171 HHMQEQHPQHHQPHHQQQHMMYGGQQGANMHQQGPPH 207 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 188 RYFDFMVFGFLLRHDITEQHQKANQP 111 R F V GFL RH+ H N P Sbjct: 734 RRFVVAVVGFLRRHNFKGLHLDWNYP 759 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,337 Number of Sequences: 336 Number of extensions: 4151 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -