BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a17 (774 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) 96 3e-20 SB_54785| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 4e-20 SB_1245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) 31 1.4 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_20789| Best HMM Match : GATA (HMM E-Value=7.4) 29 4.2 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) 28 7.3 SB_37181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) 28 9.6 SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) 28 9.6 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 28 9.6 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 28 9.6 >SB_11216| Best HMM Match : GILT (HMM E-Value=6.7e-10) Length = 311 Score = 95.9 bits (228), Expect = 3e-20 Identities = 51/187 (27%), Positives = 89/187 (47%) Frame = +3 Query: 153 KKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWRDFRGLVKVKMVPYGKSTHDKVDGKW 332 K+ + KVK+AVYY S P+ ++F+ QL P ++ + MVP+G K + Sbjct: 20 KQTKKAEKVKLAVYYNSKNPEFRRFMVAQLYPTSNKIPNILDISMVPFGDGKEIKAKSGF 79 Query: 333 SFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTSPDKSLDTCLTQVDKMSE 512 + C +GA+EC N +QAC + N + + S DK C Q+ + Sbjct: 80 QYYCTNGAEECLENLIQACAVATENNPEILTSFVGCLSYYDGSVDKIAKYCSNQI---KD 136 Query: 513 SDKLKRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVC 692 +K++ C + QG ++ KT + ++ P + +N ++ + ++ QA ENL +VC Sbjct: 137 YEKVEYCLKNTQGLEVMHYMAKKTRGLQPKMSHSPWITVNGEHSEFIQQQAMENLLQLVC 196 Query: 693 RVATPQP 713 V P Sbjct: 197 TVNWTSP 203 >SB_54785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 95.5 bits (227), Expect = 4e-20 Identities = 52/187 (27%), Positives = 96/187 (51%), Gaps = 5/187 (2%) Frame = +3 Query: 177 VKIAVYYESLCPDSKKFITTQLAPVWRDFRGLVKVKMVPYGKSTHDKVDGKWSFICHHGA 356 V I++YYES+C + I QL P ++ ++ + +VPYG + + KW F C HG Sbjct: 27 VAISLYYESMCGGCRDMIRDQLYPTFQKVGSIMDITLVPYGNAQEYRYGNKWVFNCQHGQ 86 Query: 357 DECYGNKVQACVLKD-RNLQDTEKMEIVIC---LMNQTSPDKSLDTCLTQVDKMSESDKL 524 EC GN ++ C + +N+ + + C ++ +P + C Q+ + + Sbjct: 87 GECEGNIIEVCAINVLKNI--SAYFPFIHCFEQFISSYNPSSTAQYCAKQLG--IDYAPI 142 Query: 525 KRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVC-RVA 701 ++CAS QG+ L G +TDA++ +VP V +N ++ ++++ QA N+ +VC Sbjct: 143 EKCASGLQGNELEHEMGVETDALVPRHNYVPWVTLNGEHTEEIQNQATFNMLGLVCDNYQ 202 Query: 702 TPQPSIC 722 +P+ C Sbjct: 203 GARPAAC 209 >SB_1245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.1 bits (67), Expect = 1.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 377 GASLRPEGPQPPGHGEDGDCNMPHEPDQPRQVFGHVLNSSRQDVGV 514 G SL P +GD +P D PR++ H+L + R D G+ Sbjct: 11 GRSLNPAIDVGQSRAAEGDYKIPSLRDIPREMNVHILKNMRNDKGI 56 >SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) Length = 1421 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 364 HSSAPWWQMNDHFPSTLS 311 HS+ +W NDHFPS+LS Sbjct: 585 HSNHRYWYYNDHFPSSLS 602 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = +3 Query: 390 VLKDRNLQDTEKMEIVICLMNQTSPDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLAS 569 V + R+L+D I + + S + + + + +E KL+ CA ++ GD+++ Sbjct: 1155 VTEVRSLKDHISCAIKCLVFHNLSQLRGITREICGLRGFAEKAKLRACAEAQSGDSVVFH 1214 Query: 570 YGDK 581 Y DK Sbjct: 1215 YDDK 1218 >SB_20789| Best HMM Match : GATA (HMM E-Value=7.4) Length = 471 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 317 LVVRALPIRDHFDFDKSSEVPPDGSQLRRYKLFAVRTKGF 198 + ++A+ R HFDF + PD S +R+ L +R G+ Sbjct: 209 IAIKAMKWRSHFDFLSDKSIVPD-SFMRKILLKGIRRHGY 247 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 28.3 bits (60), Expect = 7.3 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 4/74 (5%) Frame = +3 Query: 312 DKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVI-CLMNQTSPD---KSLD 479 ++ D KW HG DE +Q C L +R + + + EI + ++ P+ SLD Sbjct: 4004 EEQDNKWELFIKHGTDE-NPLHIQLCFLINRLIGNHVEKEIYLQAMLACRVPEDILPSLD 4062 Query: 480 TCLTQVDKMSESDK 521 C D +S SDK Sbjct: 4063 RCGVAQDLLS-SDK 4075 >SB_19371| Best HMM Match : C_tripleX (HMM E-Value=0.041) Length = 942 Score = 28.3 bits (60), Expect = 7.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 419 GEDGDCNMPHEPDQPRQV 472 GE+G+C EP+ PRQ+ Sbjct: 173 GENGECQYSREPEPPRQI 190 >SB_37181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 334 DHFPSTLSCVLFPYGTILTLTSPL 263 D FP SC FPY ++++ SP+ Sbjct: 96 DVFPIACSCRCFPYHVLMSMCSPI 119 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 195 YESLCPDSKKFITTQLAPVWRDFRGLVKVKMVP 293 + + PD+ + I +L P++ D+ ++KVK+ P Sbjct: 3409 FRVIAPDTIRDINDELVPLFDDYHKVMKVKLSP 3441 >SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) Length = 540 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 334 DHFPSTLSCVLFPYGTILTLTSPL 263 D FP SC FPY ++++ SP+ Sbjct: 246 DVFPIACSCRCFPYHVLMSMCSPI 269 >SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) Length = 533 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 334 DHFPSTLSCVLFPYGTILTLTSPL 263 D FP SC FPY ++++ SP+ Sbjct: 54 DVFPIACSCRCFPYHVLMSMCSPI 77 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 507 SESDKLKRCASSEQGDNLLASYGDK 581 +E KL+ CA ++ GD+++ Y DK Sbjct: 17 AEKAKLRACAEAQSGDSVVFHYDDK 41 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 27.9 bits (59), Expect = 9.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 538 PVNKETICSRRTVIKRML**DLSRSCPPLLLTRNTTK 648 P E +C+ R + + SRSCPP ++ TTK Sbjct: 417 PAGNENLCNFRVRVNDVEPPTCSRSCPPDIIKELTTK 453 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,392,567 Number of Sequences: 59808 Number of extensions: 576025 Number of successful extensions: 1563 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -