BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a17 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12870.1 68417.m02015 gamma interferon responsive lysosomal t... 84 9e-17 At4g12960.1 68417.m02025 gamma interferon responsive lysosomal t... 79 2e-15 At1g07080.1 68414.m00754 gamma interferon responsive lysosomal t... 77 2e-14 At4g12890.1 68417.m02017 gamma interferon responsive lysosomal t... 75 7e-14 At4g12900.1 68417.m02018 gamma interferon responsive lysosomal t... 69 5e-12 At5g01580.1 68418.m00073 gamma interferon responsive lysosomal t... 61 7e-10 At2g44580.1 68415.m05548 zinc finger (C3HC4-type RING finger) fa... 38 0.010 At3g23980.1 68416.m03012 dentin sialophosphoprotein-related cont... 30 1.5 At4g38350.1 68417.m05422 patched family protein similar to SP|O1... 30 2.0 At1g42470.1 68414.m04897 patched family protein similar to SP|O1... 29 2.6 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 29 2.6 At5g43130.1 68418.m05265 transcription initiation factor IID (TF... 29 3.4 At4g03420.1 68417.m00469 expressed protein 29 4.5 At1g06490.1 68414.m00688 glycosyl transferase family 48 protein ... 29 4.5 At3g59140.1 68416.m06593 ABC transporter family protein putative... 28 6.0 At1g60180.1 68414.m06779 hypothetical protein similar to hypothe... 28 6.0 At5g38260.1 68418.m04612 serine/threonine protein kinase, putati... 28 7.9 At2g37730.1 68415.m04627 fringe-related protein similarity to pr... 28 7.9 >At4g12870.1 68417.m02015 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 229 Score = 84.2 bits (199), Expect = 9e-17 Identities = 63/211 (29%), Positives = 99/211 (46%), Gaps = 6/211 (2%) Frame = +3 Query: 111 RLVCFLMLLCYVVAKKKT--EDHKVKIAVYYESLCPDSKKFITTQLAPVW-RDFRGLVKV 281 +LV F + + + K E KV++ +YYESLCP + FI +L V+ D + V Sbjct: 9 KLVFFACFVLFTFSHKLVTGESDKVELNLYYESLCPGCQSFIVDELVKVFDSDLDTITDV 68 Query: 282 KMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTS 461 K+VP+G + KV + IC HG +EC N ++ACV+ + + + C+ N T Sbjct: 69 KLVPFG---YAKVSNNLTVICQHGEEECKLNALEACVINTLP-NPKSQYKFIRCVENNT- 123 Query: 462 PDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKY 641 D +CL + C +S+ L+ Y +T ++ FVP V IN Sbjct: 124 -DNWESSCL---KGYGNEKAINDCYNSDLSKKLILGYAKQTSSLKPKHEFVPWVTIN--- 176 Query: 642 DKDVETQAFENLKAVVCRV---ATPQPSICS 725 K + T+ ++L VC+ TP P CS Sbjct: 177 SKPLYTK-LDDLVGQVCKAYKGKTPLPIDCS 206 >At4g12960.1 68417.m02025 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 233 Score = 79.4 bits (187), Expect = 2e-15 Identities = 57/211 (27%), Positives = 99/211 (46%), Gaps = 6/211 (2%) Frame = +3 Query: 111 RLVCF--LMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVW-RDFRGLVKV 281 +LV F L+LL + + KVK+ +YYESLCP ++FI L ++ D + + Sbjct: 8 KLVFFGCLLLLTFTDNLVAGKSGKVKLNLYYESLCPGCQEFIVDDLGKIFDYDLYTITDL 67 Query: 282 KMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTS 461 K+ P+G + ++ + C HG +EC N ++AC L+ Q ++ + C+ + T Sbjct: 68 KLFPFGNA---ELSDNLTVTCQHGEEECKLNALEACALRTWPDQKSQ-YSFIRCVESDT- 122 Query: 462 PDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKY 641 K ++C V + C + + L+ Y KT + P +VP V +N K Sbjct: 123 --KGWESC---VKNSGREKAINDCYNGDLSRKLILGYATKTKNLKPPHEYVPWVTLNGK- 176 Query: 642 DKDVETQAFENLKAVVCRV---ATPQPSICS 725 D Q+ ++L A +C T P +C+ Sbjct: 177 PLDDSVQSTDDLVAQICNAYKGKTTLPKVCN 207 >At1g07080.1 68414.m00754 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 265 Score = 76.6 bits (180), Expect = 2e-14 Identities = 51/176 (28%), Positives = 90/176 (51%), Gaps = 2/176 (1%) Frame = +3 Query: 174 KVKIAVYYESLCPDSKKFITTQLAPVWR-DFRGLVKVKMVPYGKSTHDKVDGKWSFICHH 350 KV + +YYESLCP FI LA ++ D +V + + P+G +T + D + +C H Sbjct: 38 KVSVGLYYESLCPYCSSFIVNHLAKLFEDDLISIVDLHLSPWG-NTKLRSDNV-TAVCQH 95 Query: 351 GADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTSPDKSLDTCLTQVDKMSESDK-LK 527 GA EC+ + V+AC + D + ++ + C+ + K D T +K++ + K + Sbjct: 96 GAFECFLDTVEACAI-DAWPKVSDHFPFIYCVEKLVTEHK-YDKWETCYEKLNLNSKPVA 153 Query: 528 RCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEKYDKDVETQAFENLKAVVCR 695 C SS G+ L Y +T+A+ P +VP V++ D + +EN + +C+ Sbjct: 154 DCLSSGHGNELALHYAAETNALQPPHKYVPWVVV----DGQPLYEDYENFISYICK 205 >At4g12890.1 68417.m02017 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 232 Score = 74.5 bits (175), Expect = 7e-14 Identities = 54/191 (28%), Positives = 89/191 (46%), Gaps = 6/191 (3%) Frame = +3 Query: 171 HKVKIAVYYESLCPDSKKFITTQLAPVW-RDFRGLVKVKMVPYGKSTHDKVDGKWSFICH 347 +KVKI +YYESLCP + FI L ++ D + +K+VP+G + + + C Sbjct: 37 NKVKINLYYESLCPYCQNFIVDDLGKIFDSDLLKITDLKLVPFGNA---HISNNLTITCQ 93 Query: 348 HGADECYGNKVQACVLKDRNLQDTE-KMEIVICLMNQTSPDKSLDTCLTQVDKMSESDKL 524 HG +EC N ++AC + R L D + + + + C+ T+ ++C V K + Sbjct: 94 HGEEECKLNALEACGI--RTLPDPKLQYKFIRCVEKDTN---EWESC---VKKSGREKAI 145 Query: 525 KRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIINEK--YDKDVETQAFENLKAVVCRV 698 C + + L+ Y T ++ +VP V +N K YD + NL A VC+ Sbjct: 146 NDCYNGDLSQKLILGYAKLTSSLKPKHEYVPWVTLNGKPLYDN------YHNLVAQVCKA 199 Query: 699 --ATPQPSICS 725 P +CS Sbjct: 200 YKGKDLPKLCS 210 >At4g12900.1 68417.m02018 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 231 Score = 68.5 bits (160), Expect = 5e-12 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 4/178 (2%) Frame = +3 Query: 111 RLVCFLMLLCYVVAKKKT---EDHKVKIAVYYESLCPDSKKFITTQLAPVWR-DFRGLVK 278 +LV F LL + + E KVK+ +YYESLCP + FI L ++ D + Sbjct: 12 KLVFFACLLLFTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHLGKIFNTDLHTITD 71 Query: 279 VKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQT 458 +K++P+G + V + C HG +EC N ++AC ++ Q + + C+ T Sbjct: 72 LKLIPFGNA---HVSDDLTVTCQHGEEECKLNALEACAIRTWPNQRLH-YKFIRCVETNT 127 Query: 459 SPDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIIN 632 + + ++C V K + C + + L+ Y ++T ++ +VP + +N Sbjct: 128 N---AWESC---VKKYGGEKAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMTLN 179 >At5g01580.1 68418.m00073 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 233 Score = 61.3 bits (142), Expect = 7e-10 Identities = 42/179 (23%), Positives = 78/179 (43%), Gaps = 1/179 (0%) Frame = +3 Query: 99 MKTLRLVCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWR-DFRGLV 275 M + + +C + + KV +++YYE+LCP +FI +L ++ + Sbjct: 1 MASYQRLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIVNRLPKIFETGLISSI 60 Query: 276 KVKMVPYGKSTHDKVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQ 455 +++VP+G + + DG + +C HG EC N + AC + D K I Q Sbjct: 61 DLQLVPWGNAA-IRPDG--TILCQHGEAECALNAIHACAI--NAYPDVMKHFGYIYCTEQ 115 Query: 456 TSPDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLASYGDKTDAVMRPLAFVPTVIIN 632 + L+ ++ + S C + G+ L Y ++T + FVP V++N Sbjct: 116 LVLENKLEKWADCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYPAHRFVPWVVVN 174 >At2g44580.1 68415.m05548 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 624 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 315 KVDGKWSFICHHGADECYGNKVQACVLKDRNLQDTEKMEIVICLMNQTSPDKSLDTCLTQ 494 ++DG W I + D + CVLKD + D ++ E+V L+ P + CL Sbjct: 194 EIDGFWRVIDENYLDVILRMLLHNCVLKDWSFDDLDEDEVVNALVADEFPSQLASHCLRV 253 Query: 495 V-DKMSESDKLK 527 K++E+DK K Sbjct: 254 FGSKVNETDKWK 265 >At3g23980.1 68416.m03012 dentin sialophosphoprotein-related contains weak similarity to Dentin sialophosphoprotein precursor (Swiss-Prot:Q9NZW4) [Homo sapiens] Length = 736 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 250 SGGTSEDLSKSKWSRMGRARTTRWMGNG 333 SGG S DLSK+ SR + +T +GNG Sbjct: 525 SGGKSTDLSKNSTSRKNVSTSTEGLGNG 552 >At4g38350.1 68417.m05422 patched family protein similar to SP|O15118 Niemann-Pick C1 protein precursor from Homo sapiens (PID:g2276463); contains Pfam profile PF02460 Patched family Length = 1064 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 117 VCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWR 257 V ++ LC + K E K+ V ES + KKF T L+P +R Sbjct: 315 VAIVLALCSGLYNFKVETRPEKLWVGPESKAAEEKKFFDTHLSPFYR 361 >At1g42470.1 68414.m04897 patched family protein similar to SP|O15118 Niemann-Pick C1 protein precursor from Homo sapiens (GB:AAB63982) (GI:2276463); contains Pfam profile PF02460 Patched family Length = 1272 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 117 VCFLMLLCYVVAKKKTEDHKVKIAVYYESLCPDSKKFITTQLAPVWR 257 V ++LLC + + K E K+ V S + K+F T LAP +R Sbjct: 356 VSVVLLLCVGLIRFKVETRPDKLWVGSGSRAAEEKQFFDTHLAPFYR 402 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 377 GASLRPEGPQPPGHGEDGDCNMPHEPDQPRQ 469 G S+ P GP PP H G P+ P +Q Sbjct: 776 GYSIPPYGPPPPYHTPHGQAPQPYPPQAQQQ 806 >At5g43130.1 68418.m05265 transcription initiation factor IID (TFIID) component TAF4 family protein weak similarity to SP|O00268 Transcription initiation factor TFIID 135 kDa subunit {Homo sapiens}; contains Pfam profile PF05236: Transcription initiation factor TFIID component TAF4 family Length = 712 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 501 KMSESDKLKRCASSEQGDNLLASYGDKTD 587 K +E++KLK+ + SE+GD + S DK D Sbjct: 556 KQAEAEKLKKPSESEEGDGGVDSEKDKED 584 >At4g03420.1 68417.m00469 expressed protein Length = 310 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 435 VICLMNQTSPDKSLDTCLTQVDKMSESDKLKRCASSE 545 +I L + + +S D+ SESDKL RCAS E Sbjct: 97 LIRLRDDSEDGESRDSFSDSYSDESESDKLSRCASDE 133 >At1g06490.1 68414.m00688 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1933 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = +3 Query: 135 LCYVVAKKKTEDHKVKIA-VY------YESLCPDSKKFITTQLAPVWRDFRGLVKVKMVP 293 LCY+ E H + VY YE+ PD + F+ + P+++ R +V+ Sbjct: 363 LCYIFHNMANEVHGILFGNVYPVTGDTYEAGAPDEEAFLRNVITPIYQVLR--KEVRRNK 420 Query: 294 YGKSTHDK 317 GK++H K Sbjct: 421 NGKASHSK 428 >At3g59140.1 68416.m06593 ABC transporter family protein putative multi resistance protein mrp - Arabidopsis thaliana, EMBL:ATMRPPROT Length = 1453 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +3 Query: 411 QDTEKMEIVICLMNQTSPDKSLDTCLTQVDKMSESDKLKRCASSEQGDNLLASY 572 ++T E V+ + N T P K ++ ++ K+ + +L + E+GD L Y Sbjct: 827 RETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREKGDTGLRPY 880 >At1g60180.1 68414.m06779 hypothetical protein similar to hypothetical protein GI:6017113 from [Arabidopsis thaliana] Length = 296 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 590 SIRFITVRREQIVSLFTGCASFQFIRLRHLVYLS 489 S+RF + E I + +GC + + L H +YL+ Sbjct: 16 SLRFCELSDECIAKILSGCPILESLTLSHCIYLT 49 >At5g38260.1 68418.m04612 serine/threonine protein kinase, putative similar to receptor serine/threonine kinase PR55K gi|1235680|gb|AAC49208; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 638 Score = 27.9 bits (59), Expect = 7.9 Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 5/86 (5%) Frame = +3 Query: 219 KKFITTQLAPVWRDFRGLVKVKMVPYGK-----STHDKVDGKWSFICHHGADECYGNKVQ 383 K+ + L P + +GLV++K Y + GK F +G + C G KV Sbjct: 288 KRRTSHHLRPRDNNLKGLVQLKQYSYAEVRKITKLFSHTLGKGGFGTVYGGNLCDGRKVA 347 Query: 384 ACVLKDRNLQDTEKMEIVICLMNQTS 461 +LKD + E + M+QTS Sbjct: 348 VKILKDFK-SNGEDFINEVASMSQTS 372 >At2g37730.1 68415.m04627 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 532 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = -1 Query: 591 QHPFYHRTTRADCLLVHWMRIFSVYPTPTSCLLELSTCPKTCRGWSGS 448 QH F H TR + V W +YPT + EL T T + W S Sbjct: 352 QHSFCHDQTRNWYVSVSWGYTIQIYPTLVTA-KELETPFLTFKSWRTS 398 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,539,690 Number of Sequences: 28952 Number of extensions: 379279 Number of successful extensions: 1170 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1162 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -