BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a16 (533 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF036487-1|ABO65073.1| 103|Homo sapiens mitochondrial ribosomal... 46 6e-05 BC104652-1|AAI04653.1| 103|Homo sapiens mitochondrial ribosomal... 46 8e-05 BC020642-1|AAH20642.1| 103|Homo sapiens mitochondrial ribosomal... 46 8e-05 AF155653-1|AAF67010.1| 103|Homo sapiens putative ribosomal prot... 46 8e-05 AF151109-1|AAF04788.1| 120|Homo sapiens putative BRCA1-interact... 46 8e-05 AB049654-1|BAB40859.1| 103|Homo sapiens mitochondrial ribosomal... 46 8e-05 >EF036487-1|ABO65073.1| 103|Homo sapiens mitochondrial ribosomal protein L36 protein. Length = 103 Score = 46.4 bits (105), Expect = 6e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 47 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRXRWYVYCKTHPRHKQRQM 103 >BC104652-1|AAI04653.1| 103|Homo sapiens mitochondrial ribosomal protein L36 protein. Length = 103 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 47 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM 103 >BC020642-1|AAH20642.1| 103|Homo sapiens mitochondrial ribosomal protein L36 protein. Length = 103 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 47 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM 103 >AF155653-1|AAF67010.1| 103|Homo sapiens putative ribosomal protein L36 protein. Length = 103 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 47 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM 103 >AF151109-1|AAF04788.1| 120|Homo sapiens putative BRCA1-interacting protein protein. Length = 120 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 64 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM 120 >AB049654-1|BAB40859.1| 103|Homo sapiens mitochondrial ribosomal protein L36 (L36mt) protein. Length = 103 Score = 46.0 bits (104), Expect = 8e-05 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 207 SVTNFVKP-VIPLVTQISGIKIKGRVRRRCRSCYFVFRDERVYIMCSKFPRHKQMSM 374 +V + + P ++P + G K K +++RC+ CY V R R Y+ C PRHKQ M Sbjct: 47 AVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM 103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,232,785 Number of Sequences: 237096 Number of extensions: 1374700 Number of successful extensions: 2154 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2154 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -