BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a15 (810 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 1.2 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 23 2.2 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -2 Query: 329 DSLHFFSLPNAKSKELMVSFSN 264 D+L F PN + +E+++ FSN Sbjct: 652 DTLQQFLTPNMRVQEVVIQFSN 673 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 514 GTFSGSNCNTATRPVDLNEKNEHLERYFRSAEIWSD 621 GT+ GS+ TR + + NE E Y W D Sbjct: 281 GTYGGSDAGPYTREMGVIGYNEVCELYSDWDYFWDD 316 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,667 Number of Sequences: 336 Number of extensions: 4375 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22102797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -