BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a15 (810 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0476 - 17922072-17922469,17922546-17923241,17923405-179235... 32 0.62 01_07_0298 - 42586007-42589742,42590167-42590280,42590295-425904... 31 1.4 11_04_0281 + 15733505-15733647,15734366-15734443,15734835-157350... 28 7.6 08_01_0098 - 700443-700660,701112-701268,701586-701678,701763-70... 28 7.6 >09_04_0476 - 17922072-17922469,17922546-17923241,17923405-17923569, 17923670-17924105,17924314-17924739 Length = 706 Score = 31.9 bits (69), Expect = 0.62 Identities = 23/101 (22%), Positives = 47/101 (46%), Gaps = 11/101 (10%) Frame = +1 Query: 364 PTIRHRNDILMNSSRAST---FSHGLDNISLMSMNFSHYELMRNLSQ--------ANSNS 510 P + ND ++ + +T FS+ + I ++ N Y MR +S ++ + Sbjct: 99 PVTKQMNDSMVGQNFTNTPYRFSYEDNKIFVIGCNTMAY--MRGVSYVIGCLSTCSDEPT 156 Query: 511 DGTFSGSNCNTATRPVDLNEKNEHLERYFRSAEIWSDRNCG 633 +G+ SG+ C + P DL + + + +++IW+ CG Sbjct: 157 NGSCSGAGCCSVDVPPDLGYVEAYFNKDYNTSQIWNYSRCG 197 >01_07_0298 - 42586007-42589742,42590167-42590280,42590295-42590437, 42591174-42591347 Length = 1388 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 367 TIRHRNDILMNSSRASTFSHG-LDNISLMSMNFSHYELMRNLSQANSNSDGTFSGSNCN- 540 T + D+++ + +A S G ++N++ F +YE + S A ++ DGT SG C+ Sbjct: 1214 TSQRVTDVVLMAFQACACSQGCMNNLTFGDDTFGYYETIGGGSGAGASWDGT-SGVQCHM 1272 Query: 541 TATRPVD 561 T TR D Sbjct: 1273 TNTRMTD 1279 >11_04_0281 + 15733505-15733647,15734366-15734443,15734835-15735077, 15735868-15736012,15736234-15736293,15736376-15736471, 15736651-15737067,15737824-15737964,15738043-15738213, 15738394-15738651,15738741-15738889,15739060-15739557, 15740147-15740420,15740631-15740696,15740891-15741057, 15741413-15741497,15741673-15741732 Length = 1016 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 596 SVVRKYGAIGTADLVDYSFSTQKN-SFRVHK*KVEMNDYVI 715 +V+R+ GAI DL+D + S N +H VE DY++ Sbjct: 103 NVLRRPGAIDNTDLIDDTASEVSNMEIELHDTLVEGRDYIL 143 >08_01_0098 - 700443-700660,701112-701268,701586-701678,701763-702149, 702755-702829,703486-703609,703693-703832,703904-703993, 704254-704298,704917-705042,705138-705272,705966-706451, 706539-706596,706728-706855,707209-707463 Length = 838 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = +1 Query: 451 SMNFSHYELMRNLSQANSNSDGTFSGSNCNTATRPVDLNEKNEHLERYF 597 SM + + R + A+ S F C +DL EH+ R+F Sbjct: 645 SMEVNLVDGSRRENTASKESKSNFYSDKCTAYMSNIDLTANEEHIRRFF 693 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,481,148 Number of Sequences: 37544 Number of extensions: 379393 Number of successful extensions: 846 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -