BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a14 (761 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC004542-2|AAC12954.1| 818|Homo sapiens WUGSC:H_DJ430N08.2 prot... 30 7.8 >AC004542-2|AAC12954.1| 818|Homo sapiens WUGSC:H_DJ430N08.2 protein. Length = 818 Score = 30.3 bits (65), Expect = 7.8 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 5/112 (4%) Frame = +3 Query: 174 LHSTSRHFIPPAFGIEGY---ARIGNPLTNPSVVEIKPKTTAGQNKYCLKYLY-SELFAT 341 L + R+F+PP+F I A + L + + E + G C Y ++ A Sbjct: 688 LRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAK 747 Query: 342 AIEDAI-IAYRILAESNSEMRIQKTLSDMPILLAKKYSVEQPAFADELDSID 494 A E+++ + R L E+ E ++QK +++ LL K V AF +LD +D Sbjct: 748 ASEESLRTSERKLRET--EEKLQKLRTNIVALLQKVQEVSPAAFLLQLDHLD 797 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,638,663 Number of Sequences: 237096 Number of extensions: 1554996 Number of successful extensions: 2657 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2657 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -