BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a12 (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Sch... 28 1.1 SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo... 26 3.5 SPAC6C3.07 |mug68||sequence orphan|Schizosaccharomyces pombe|chr... 26 3.5 SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyce... 26 4.6 SPAC22H10.13 |zym1||metallothionein |Schizosaccharomyces pombe|c... 26 4.6 SPBC887.08 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 6.1 >SPAC22F8.12c |shf1||small histone ubiquitination factor Shf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 165 Score = 27.9 bits (59), Expect = 1.1 Identities = 18/71 (25%), Positives = 30/71 (42%) Frame = +3 Query: 81 SYYTATKDVLNKQKLSFSYHFLAISKMSTKYHKNCTKDPNELEDPTRKQPDEQLTRKLKP 260 S Y + N ++ + YH+ S ST+ +E P PD L+ KL+ Sbjct: 50 SSYDSPSSSTNSKEHNSPYHYRVPSNNSTRASFGAASTDTNVELPKINLPDSSLSSKLQ- 108 Query: 261 LTTKPLCDCSN 293 + K C+ S+ Sbjct: 109 -SCKSACENSS 118 >SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharomyces pombe|chr 1|||Manual Length = 117 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/54 (24%), Positives = 25/54 (46%) Frame = +3 Query: 216 TRKQPDEQLTRKLKPLTTKPLCDCSNCTCKDCPDVLKTFSINVTEDSCDFGTKK 377 ++ PD L R+ +T LC+ + C C ++ ++ D C FG+ + Sbjct: 2 SKHHPDLVLCRRQPGITVGKLCERCDEKCPICDSHVRPTTLVRICDECAFGSSQ 55 >SPAC6C3.07 |mug68||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 515 Score = 26.2 bits (55), Expect = 3.5 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 9/75 (12%) Frame = +3 Query: 51 QQQCIYIAK-HSYYTATKDVLNKQKLSFSYHFLAISKMSTKYHKN------CTKDPNELE 209 Q Q I I+K + T T+DV+NK + L K S K+ N CT + +E+ Sbjct: 241 QMQKIKISKLGTAETQTEDVMNKSSQKENNDILRKHKTSVKFPTNLDALNSCTMENHEIN 300 Query: 210 D--PTRKQPDEQLTR 248 + T K D +T+ Sbjct: 301 ELTATNKMNDGPITK 315 >SPBC609.05 |pob3||FACT complex component Pob3|Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.8 bits (54), Expect = 4.6 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -1 Query: 451 LFNTSSKLWQSFMDTSCELSSICSTFFVPKSQESSVTLI 335 ++ T +L D E SSI S F +PK E V + Sbjct: 233 MYETCMRLRGKTYDYKVEYSSINSLFLLPKPDEQHVVFV 271 >SPAC22H10.13 |zym1||metallothionein |Schizosaccharomyces pombe|chr 1|||Manual Length = 50 Score = 25.8 bits (54), Expect = 4.6 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +3 Query: 243 TRKLKPLTTKPLCDC-SNCTCKDCPD 317 T + K KP CDC S C C+DC + Sbjct: 4 TTQCKSKQGKP-CDCQSKCGCQDCKE 28 >SPBC887.08 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 124 Score = 25.4 bits (53), Expect = 6.1 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 54 QQCIYIAKHSYYTATKDVLNKQKLSFSYHFLAISKMSTKYHKNCTKDPNELEDPTRK 224 +Q + A+ YY + +K +F + S +YH+ + + NE+ED R+ Sbjct: 59 EQSKFAAEEQYYLGNYSLA--KKFAFQALDVPTDSSSIEYHRLSSGEINEIEDIIRR 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,238,820 Number of Sequences: 5004 Number of extensions: 44204 Number of successful extensions: 173 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 171 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -