BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a10 (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37830.1 68417.m05352 cytochrome c oxidase-related contains w... 33 0.12 At5g02400.1 68418.m00163 protein phosphatase 2C family protein /... 31 0.65 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 31 0.65 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 3.5 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 29 3.5 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 28 4.6 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 28 4.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 28 4.6 At3g58590.1 68416.m06530 pentatricopeptide (PPR) repeat-containi... 28 6.1 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 6.1 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 27 8.0 At4g32640.1 68417.m04646 sec23/sec24 transport protein-related 27 8.0 At4g16745.1 68417.m02529 exostosin family protein contains Pfam ... 27 8.0 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 27 8.0 >At4g37830.1 68417.m05352 cytochrome c oxidase-related contains weak similarity to cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor (EC 1.9.3.1) (Swiss-Prot:P10818) [Rattus norvegicus] Length = 102 Score = 33.5 bits (73), Expect = 0.12 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +3 Query: 327 KYRNFTYFVLLPLIAIQSFN-ALGHEPPPKGPCRDYEYMRVRTKRFPWG-DGVKSFYHN- 497 K+ TY + A+ + + GH P Y +M +R K FPWG DG+ HN Sbjct: 43 KWEKITYLGIASCTALAVYVLSKGHHHGEDPPA--YPHMHIRNKEFPWGPDGLFEVKHNK 100 Query: 498 EH 503 EH Sbjct: 101 EH 102 >At5g02400.1 68418.m00163 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2c (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 674 Score = 31.1 bits (67), Expect = 0.65 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = +3 Query: 87 PNYN*NMRFNVINKFKRPLIWTVEKARRYSLCGPPRPSKCGCPPKPGSGKVIVP 248 P+Y N + + K L+W EK R G + KC P SGK P Sbjct: 290 PDYLLNNLYTAVQKELNGLLWNDEKLRSLGENGMTKTGKCSDEEDPESGKENCP 343 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 31.1 bits (67), Expect = 0.65 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +3 Query: 183 GPP---RPSKCGCPPKPGSGKVIVPPADCKPGPICYNPCVPRFHHG 311 GPP RP G PP G G + PP+ GP+ P H G Sbjct: 159 GPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGG 204 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 28.7 bits (61), Expect = 3.5 Identities = 24/82 (29%), Positives = 33/82 (40%), Gaps = 6/82 (7%) Frame = +3 Query: 186 PPRPSKCGCPPKP----GSGKVIVPPADCKPGPICYNPCVPRFH--HGKDTWKKYRNFTY 347 PP P C CPP P S KV+ P P YN P ++ K +K +Y Sbjct: 662 PPHPHVCVCPPPPPCYSPSPKVVY---KSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSY 718 Query: 348 FVLLPLIAIQSFNALGHEPPPK 413 + P + +S + P PK Sbjct: 719 YSPSPKVEYKSPPPPSYSPSPK 740 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 189 PRPSKCGCPPKPGSGKVIVPPADCKPGP 272 P PS C PP K + PPA C P P Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPA-CPPTP 72 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 174 SLCGPPRPSKCGCPPKPGSGKVIVPP---ADCKPGPICYNPCVPR 299 S GPPRP PP G K PP P P+ P PR Sbjct: 381 SSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPR 425 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 174 SLCGPPRPSKCGCPPKPGSGKVIVPP---ADCKPGPICYNPCVPR 299 S GPPRP PP G K PP P P+ P PR Sbjct: 381 SSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPR 425 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 117 VINKFKRPLIWTVEKARRYSLCGPPRPSKCGCPPKPGSGKVIVPPA 254 + +K ++P + E A S PP PS PP P K +V PA Sbjct: 199 IASKLEQPKV-KKEVAVESSRLSPPSPSPSRLPPTPPLPKFLVSPA 243 >At3g58590.1 68416.m06530 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 741 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 228 CQALEDSRICLDVVDHKDCSVWLFQLS 148 C LEDSR+C D + K+ W LS Sbjct: 364 CGNLEDSRLCFDYIRDKNIVCWNALLS 390 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +3 Query: 186 PPRPSKCGCPPKP----GSGKVIVPPADCKPGPICYNPCVPRFH 305 PP P C CPP P S KV+ + P P Y+ P +H Sbjct: 629 PPHPHVCVCPPPPPCYSPSPKVVYKSS---PPPYVYSSPPPPYH 669 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 27.5 bits (58), Expect = 8.0 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 186 PPRPSKCGCPPKPGSGKVIVPPADCKPGPICYNPCVPRFHH 308 PP P G PP PG G PPA PG Y P HH Sbjct: 62 PPAPGYGGYPPAPGYGG--YPPA---PGHGGYPPAGYPAHH 97 >At4g32640.1 68417.m04646 sec23/sec24 transport protein-related Length = 1069 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 183 GPP---RPSKCGCPPKPGSGKVIVPPADCKPGPI 275 GPP RP G PP GSG + +PP+ GP+ Sbjct: 161 GPPPGSRPMAFGSPPPVGSG-MSMPPSGMIGGPV 193 >At4g16745.1 68417.m02529 exostosin family protein contains Pfam PF03016: Exostosin family Length = 542 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 423 RDYEYMRVRTKRFPWGDGVKSFYHNEHVN 509 R YE M + K + + DG K +H H+N Sbjct: 191 RSYELMELILKVYIYPDGDKPIFHEPHLN 219 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 186 PPRPSKCGCPPKPGSGKVIVPPADCKPGPICYNPCVPR 299 PP PS CPP P S PP P P P P+ Sbjct: 71 PPPPSPPPCPPPP-SPPPSPPPPQLPPPPQLPPPAPPK 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,206,504 Number of Sequences: 28952 Number of extensions: 324354 Number of successful extensions: 909 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -