BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a06 (752 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.58 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 1.0 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 22 7.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 7.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.4 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.58 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 382 EAEPFINKLRKTTATPSTTKVNKGKQLNSNWRQKHEEFI 498 EA ++KL KT TP+ + + +L N + +E+F+ Sbjct: 526 EAANIMSKLPKTVRTPTDSYIRSFFELLQNPKVSNEQFL 564 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 1.0 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +3 Query: 444 EQRQAIEQQLATKTRRVHPGNTSGETSAGTFECWR*AERSAAPSAVGE 587 +Q+Q +QQ R G ETSAGT A+ S P V E Sbjct: 1224 QQQQQQQQQQHQAREREGVGAGIAETSAGTSNSRGAAQMSKVPRDVSE 1271 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/18 (50%), Positives = 12/18 (66%), Gaps = 1/18 (5%) Frame = +1 Query: 604 CPHCNRRFNQGA-AERHI 654 C HC+R+F Q A RH+ Sbjct: 40 CSHCDRQFVQVANLRRHL 57 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 103 SETNKTRGAMQRPANTTPRKPPVKANSAGSGTPKG 207 +ET + A TP P V SA +GT G Sbjct: 35 AETPEHLAGTSTTAAATPTPPSVPVGSAVAGTAGG 69 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 712 PGNPKAHY 735 PGNP AHY Sbjct: 185 PGNPLAHY 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,595 Number of Sequences: 438 Number of extensions: 3622 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -