BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a04 (708 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g36170.2 68418.m04359 peptide chain release factor, putative ... 49 3e-06 At5g36170.1 68418.m04358 peptide chain release factor, putative ... 49 3e-06 At1g56350.1 68414.m06479 peptide chain release factor, putative ... 48 5e-06 At5g36170.3 68418.m04360 peptide chain release factor, putative ... 43 2e-04 At2g47020.2 68415.m05874 peptide chain release factor, putative ... 42 3e-04 At2g47020.1 68415.m05875 peptide chain release factor, putative ... 42 3e-04 At1g33330.1 68414.m04123 peptide chain release factor, putative ... 42 4e-04 At3g62910.1 68416.m07067 peptide chain release factor, putative ... 38 0.005 At1g60070.1 68414.m06767 gamma-adaptin, putative similar to gamm... 32 0.32 At1g03830.1 68414.m00364 guanylate-binding family protein contai... 31 0.57 At5g61220.1 68418.m07679 complex 1 family protein / LVR family p... 30 1.7 At2g26780.1 68415.m03212 expressed protein contains Pfam profile... 29 2.3 At5g20040.2 68418.m02385 tRNA isopentenyltransferase 9 / IPP tra... 29 3.0 At5g20040.1 68418.m02384 tRNA isopentenyltransferase 9 / IPP tra... 29 3.0 At2g39725.2 68415.m04876 complex 1 family protein / LVR family p... 29 3.0 At2g39725.1 68415.m04875 complex 1 family protein / LVR family p... 29 3.0 At5g67170.2 68418.m08468 SEC-C motif-containing protein / OTU-li... 29 4.0 At5g67170.1 68418.m08467 SEC-C motif-containing protein / OTU-li... 29 4.0 At2g42250.1 68415.m05230 cytochrome P450 family protein similar ... 29 4.0 At2g22740.2 68415.m02696 SET domain-containing protein (SUVH6) i... 27 9.2 At2g22740.1 68415.m02695 SET domain-containing protein (SUVH6) i... 27 9.2 >At5g36170.2 68418.m04359 peptide chain release factor, putative similar to SP|P28367 Peptide chain release factor 2 (RF-2) {Bacillus subtilis}; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 455 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/63 (41%), Positives = 33/63 (52%) Frame = +2 Query: 428 KINECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLI 607 +I E +L F R G GG VNK V +THIPTG ++C R Q N+ +A L Sbjct: 312 EIPEEDLDISFTRAGGKGGQNVNKVETAVRITHIPTGVAVRCTEERSQLANKTRALIRLK 371 Query: 608 EKL 616 KL Sbjct: 372 AKL 374 >At5g36170.1 68418.m04358 peptide chain release factor, putative similar to SP|P28367 Peptide chain release factor 2 (RF-2) {Bacillus subtilis}; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 456 Score = 49.2 bits (112), Expect = 3e-06 Identities = 26/63 (41%), Positives = 33/63 (52%) Frame = +2 Query: 428 KINECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLI 607 +I E +L F R G GG VNK V +THIPTG ++C R Q N+ +A L Sbjct: 313 EIPEEDLDISFTRAGGKGGQNVNKVETAVRITHIPTGVAVRCTEERSQLANKTRALIRLK 372 Query: 608 EKL 616 KL Sbjct: 373 AKL 375 >At1g56350.1 68414.m06479 peptide chain release factor, putative similar to SP|P28353 Peptide chain release factor 2 (RF-2). {Salmonella typhi}; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 482 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/72 (33%), Positives = 34/72 (47%) Frame = +2 Query: 410 DYSKVPKINECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKK 589 D S +IN+ +L + R G GG N + V + HIPTG C R Q N+ Sbjct: 336 DGSTRVEINDSDLRIERFRSGGAGGQHANTTDSAVRIVHIPTGITATCQNERSQHSNKAS 395 Query: 590 ARELLIEKLDDM 625 A +L +LD + Sbjct: 396 AMAVLQSRLDQL 407 >At5g36170.3 68418.m04360 peptide chain release factor, putative similar to SP|P28367 Peptide chain release factor 2 (RF-2) {Bacillus subtilis}; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 391 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/42 (45%), Positives = 24/42 (57%) Frame = +2 Query: 428 KINECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKC 553 +I E +L F R G GG VNK V +THIPTG ++C Sbjct: 313 EIPEEDLDISFTRAGGKGGQNVNKVETAVRITHIPTGVAVRC 354 >At2g47020.2 68415.m05874 peptide chain release factor, putative similar to peptide chain release factor 1 [Escherichia coli] GI:147567; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 348 Score = 42.3 bits (95), Expect = 3e-04 Identities = 27/90 (30%), Positives = 41/90 (45%) Frame = +2 Query: 347 LTSKYFRNFSPRLAAAFKHTIDYSKVPKINECELSEKFVRGSGPGGSAVNKNSNCVVLTH 526 +T K R + ++ A D V NE +L R G GG N ++ V + H Sbjct: 177 ITEKSGRIHTSAISVAILPQADEVDVQLRNE-DLRIDTYRSGGSGGQHANTTNSAVRIIH 235 Query: 527 IPTGTVIKCHTSRCQDDNRKKARELLIEKL 616 +PTG ++ R Q NR KA ++L +L Sbjct: 236 LPTGMMVSIQDERSQHMNRAKALKVLCARL 265 >At2g47020.1 68415.m05875 peptide chain release factor, putative similar to peptide chain release factor 1 [Escherichia coli] GI:147567; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 413 Score = 42.3 bits (95), Expect = 3e-04 Identities = 27/90 (30%), Positives = 41/90 (45%) Frame = +2 Query: 347 LTSKYFRNFSPRLAAAFKHTIDYSKVPKINECELSEKFVRGSGPGGSAVNKNSNCVVLTH 526 +T K R + ++ A D V NE +L R G GG N ++ V + H Sbjct: 242 ITEKSGRIHTSAISVAILPQADEVDVQLRNE-DLRIDTYRSGGSGGQHANTTNSAVRIIH 300 Query: 527 IPTGTVIKCHTSRCQDDNRKKARELLIEKL 616 +PTG ++ R Q NR KA ++L +L Sbjct: 301 LPTGMMVSIQDERSQHMNRAKALKVLCARL 330 >At1g33330.1 68414.m04123 peptide chain release factor, putative similar to peptide chain release factor 2 [Campylobacter jejuni] GI:6469929; contains Pfam profile PF00472: Peptidyl-tRNA hydrolase domain Length = 257 Score = 41.9 bits (94), Expect = 4e-04 Identities = 24/54 (44%), Positives = 29/54 (53%) Frame = +2 Query: 431 INECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKA 592 + +C L E F R SGPGG NK + V L H+PTG V + R Q NR A Sbjct: 95 MKQCRL-ETF-RVSGPGGQHRNKRDSAVRLKHLPTGIVAQAVEDRSQHKNRASA 146 >At3g62910.1 68416.m07067 peptide chain release factor, putative similar to peptide chain release factor 1 [Escherichia coli] GI:147567; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 422 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/51 (41%), Positives = 26/51 (50%) Frame = +2 Query: 464 RGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLIEKL 616 R G GG VNK + L H P+G I C R Q N+ +A +LL KL Sbjct: 283 RSGGAGGQNVNKVETAIDLFHKPSGIRIFCTEERTQIRNKARAFQLLRAKL 333 >At1g60070.1 68414.m06767 gamma-adaptin, putative similar to gamma-adaptin GI:2765190 from [Homo sapiens]; contains Pfam profiles PF01602: Adaptin N terminal region, PF02883: Adaptin C-terminal domain Length = 867 Score = 32.3 bits (70), Expect = 0.32 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = +2 Query: 443 ELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLIEKLDD 622 +LSE F+ PG + + + + V++T + T I +S + RKK E L++ L D Sbjct: 173 DLSENFIN---PGAALLKEKHHGVLITGVHLCTEICKVSSEALEYFRKKCTEGLVKTLRD 229 Query: 623 MINGPES 643 + N P S Sbjct: 230 IANSPYS 236 >At1g03830.1 68414.m00364 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 991 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 563 RCQDDNRKKARELLIEKLDDMINGPESVSAQRKLIEEKKYKRNATKK 703 RC + +R K+R +EK+ + +G SA +KL++ K + A++K Sbjct: 701 RCIEIDRAKSRIEELEKVCTLNSGEGEASASKKLVDSMKMEAEASRK 747 >At5g61220.1 68418.m07679 complex 1 family protein / LVR family protein contains Pfam PF05347: Complex 1 protein (LYR family) Length = 87 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 139 ITRKEVLRLYRNLLMYSKSLK-LTDPDYFRRSIKIEFKNNQNLTDLEKISFAYQKGQALL 315 ++ EVL L R LL + +Y +R F+ N+NLTD K++ AY + + L Sbjct: 2 VSSSEVLSLCRALLRAGRQFPDYNIREYSKRRTLDGFRMNKNLTDPSKVTEAYAEAKKQL 61 >At2g26780.1 68415.m03212 expressed protein contains Pfam profile TBP (TATA-binding protein) -interacting protein 120 (TIP120); contains TIGRFAM profile TIGR01612: reticulocyte binding protein Length = 1866 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 323 GQLCDMF-LLTSKYFRNFSPRLAAAFKHTIDYSKVPKINEC 442 G+LC F L + + SP A F H + +S VPK+ EC Sbjct: 1755 GKLCSRFPSLWTDSMDDLSPSDATKFVHELFHSLVPKLLEC 1795 >At5g20040.2 68418.m02385 tRNA isopentenyltransferase 9 / IPP transferase 9 (IPT9) identical to tRNA isopentenyltransferase (IPT9) [Arabidopsis thaliana] GI:14279070 Length = 459 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 705 CFFVAF-RLYFFSSISFLCADTLSGP 631 CFF++ R+ + SI F C D LSGP Sbjct: 272 CFFLSSPRVALYRSIDFRCEDMLSGP 297 >At5g20040.1 68418.m02384 tRNA isopentenyltransferase 9 / IPP transferase 9 (IPT9) identical to tRNA isopentenyltransferase (IPT9) [Arabidopsis thaliana] GI:14279070 Length = 463 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 705 CFFVAF-RLYFFSSISFLCADTLSGP 631 CFF++ R+ + SI F C D LSGP Sbjct: 272 CFFLSSPRVALYRSIDFRCEDMLSGP 297 >At2g39725.2 68415.m04876 complex 1 family protein / LVR family protein contains Pfam PF05347: Complex 1 protein (LYR family) Length = 90 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 145 RKEVLRLYRNLLMYSKSLKLTDPDYFRRSIKIEFKNNQNLTDLEKISF 288 +K+VL LYR L ++S + D + EF++N D + + Sbjct: 10 QKQVLSLYRGFLRAARSRPIEDRKRIEMIVSTEFRHNSKEVDRKNFQY 57 >At2g39725.1 68415.m04875 complex 1 family protein / LVR family protein contains Pfam PF05347: Complex 1 protein (LYR family) Length = 90 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +1 Query: 145 RKEVLRLYRNLLMYSKSLKLTDPDYFRRSIKIEFKNNQNLTDLEKISF 288 +K+VL LYR L ++S + D + EF++N D + + Sbjct: 10 QKQVLSLYRGFLRAARSRPIEDRKRIEMIVSTEFRHNSKEVDRKNFQY 57 >At5g67170.2 68418.m08468 SEC-C motif-containing protein / OTU-like cysteine protease family protein contains Pfam profiles PF02338: OTU-like cysteine protease, PF02810: SEC-C motif Length = 374 Score = 28.7 bits (61), Expect = 4.0 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 539 TVIKCHTSRCQDDNRKKARELLIEKLDDMINGPESVSAQ-RKLIEEKKYKRNAT 697 T+ H S +N ++ARE LIE+ N E+V A+ ++KK RN T Sbjct: 262 TINPKHASDSPMENTEQAREELIEEESASGNNSETVQAKCTTQTDDKKIPRNKT 315 >At5g67170.1 68418.m08467 SEC-C motif-containing protein / OTU-like cysteine protease family protein contains Pfam profiles PF02338: OTU-like cysteine protease, PF02810: SEC-C motif Length = 375 Score = 28.7 bits (61), Expect = 4.0 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 539 TVIKCHTSRCQDDNRKKARELLIEKLDDMINGPESVSAQ-RKLIEEKKYKRNAT 697 T+ H S +N ++ARE LIE+ N E+V A+ ++KK RN T Sbjct: 263 TINPKHASDSPMENTEQAREELIEEESASGNNSETVQAKCTTQTDDKKIPRNKT 316 >At2g42250.1 68415.m05230 cytochrome P450 family protein similar to cytochrome P450 93A1 (SP:Q42798) [Glycine max] Length = 514 Score = 28.7 bits (61), Expect = 4.0 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +2 Query: 293 IRKVRPCCREGQLCDMFLLTSKYFRNFSPRLAAAFKHTIDYSKVPKINE 439 + V CCREG CD+ KY N R+A + + + ++ +I E Sbjct: 165 VDSVAKCCREGLPCDLSSQFIKYTNNVICRMAMSTRCSGTDNEAEEIRE 213 >At2g22740.2 68415.m02696 SET domain-containing protein (SUVH6) identical to SUVH6 [Arabidopsis thaliana] GI:13517753; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain Length = 790 Score = 27.5 bits (58), Expect = 9.2 Identities = 22/76 (28%), Positives = 33/76 (43%) Frame = +2 Query: 434 NECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLIEK 613 +EC SE+ V GSG S+ +N I V+ S DN + + L IE Sbjct: 140 DECSNSEQIVAGSGVSSSSGTEN--------IVRDIVVYADESSLGMDNLDQTQPLEIEM 191 Query: 614 LDDMINGPESVSAQRK 661 D + P V+ ++K Sbjct: 192 SDVAVAKPRLVAGRKK 207 >At2g22740.1 68415.m02695 SET domain-containing protein (SUVH6) identical to SUVH6 [Arabidopsis thaliana] GI:13517753; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain Length = 790 Score = 27.5 bits (58), Expect = 9.2 Identities = 22/76 (28%), Positives = 33/76 (43%) Frame = +2 Query: 434 NECELSEKFVRGSGPGGSAVNKNSNCVVLTHIPTGTVIKCHTSRCQDDNRKKARELLIEK 613 +EC SE+ V GSG S+ +N I V+ S DN + + L IE Sbjct: 140 DECSNSEQIVAGSGVSSSSGTEN--------IVRDIVVYADESSLGMDNLDQTQPLEIEM 191 Query: 614 LDDMINGPESVSAQRK 661 D + P V+ ++K Sbjct: 192 SDVAVAKPRLVAGRKK 207 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,605,024 Number of Sequences: 28952 Number of extensions: 293769 Number of successful extensions: 787 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 787 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -