BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a02 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 4.0 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.0 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 9.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.3 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.3 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 8 ISVK*TR*QQKLILFNDWIYLNLTKPL*EAVQQ 106 I+++ ++ ++ ++ ND+I N T P+ E +QQ Sbjct: 8 ITMEISKNHKEQLISNDYILDNYTSPIVEFLQQ 40 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 336 VWTIVCLHYVIAKLL 292 +WT VCL +V LL Sbjct: 306 IWTGVCLTFVFGALL 320 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 336 VWTIVCLHYVIAKLL 292 +WT VCL +V LL Sbjct: 306 IWTGVCLTFVFGALL 320 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 64 NPIIEQNQFLLLPSLFD 14 NP I +FL+ PSL D Sbjct: 95 NPFIGMGEFLIDPSLED 111 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 591 SSLANQRHTLVITPQRTSYKGIN 523 ++LA+Q +++PQ KGIN Sbjct: 208 ATLADQIKNGIVSPQEERPKGIN 230 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 591 SSLANQRHTLVITPQRTSYKGIN 523 ++LA+Q +++PQ KGIN Sbjct: 203 ATLADQIKNGIVSPQEERPKGIN 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,745 Number of Sequences: 438 Number of extensions: 3249 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -