Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10a02
         (746 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02880.1 68418.m00231 HECT-domain-containing protein / ubiqui...    28   5.7  

>At5g02880.1 68418.m00231 HECT-domain-containing protein /
            ubiquitin-transferase family protein /
            armadillo/beta-catenin-like repeat-containing protein
            similar to SP|Q14669 Thyroid receptor interacting protein
            12 (TRIP12) {Homo sapiens}; contains Pfam profiles
            PF00632: HECT-domain (ubiquitin-transferase), PF00514:
            Armadillo/beta-catenin-like repeat
          Length = 1502

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +1

Query: 409  RSVTLEKRKVTGKPAPHAENVKRKPEKKFNQKIFADIAVNT 531
            R   L+  +V  +P PH+E V  K  +K  Q++    AV+T
Sbjct: 1010 RLENLDDLRVQVRPVPHSEFVSSKLTEKLEQQLRDSFAVST 1050


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,989,247
Number of Sequences: 28952
Number of extensions: 232990
Number of successful extensions: 477
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 477
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1653386488
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)