BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a01 (466 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 2.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 2.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 2.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 2.4 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 5.6 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 7.4 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 7.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 20 9.8 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 20 9.8 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 1.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -1 Query: 151 FFNLSHFYFTLLSFIVEVLYIKFLIQILYTFYHF 50 FF L +YF +FI+ +++ FL+ I + F F Sbjct: 141 FFLLCIYYF-YCAFIIFTVHLLFLLCIYHFFCAF 173 Score = 20.2 bits (40), Expect = 9.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 151 FFNLSHFYFTLLSFIVEVLYIKFLIQILY 65 F L Y+ +FI+ +++ FL+ I Y Sbjct: 107 FIILLCVYYFYYAFIIFTVHLLFLLCIYY 135 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 161 MILIFQFVPFLFH 123 +IL+ QFV LFH Sbjct: 1336 LILVIQFVAMLFH 1348 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 161 MILIFQFVPFLFH 123 +IL+ QFV LFH Sbjct: 1336 LILVIQFVAMLFH 1348 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 161 MILIFQFVPFLFH 123 +IL+ QFV LFH Sbjct: 1336 LILVIQFVAMLFH 1348 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 161 MILIFQFVPFLFH 123 +IL+ QFV LFH Sbjct: 1336 LILVIQFVAMLFH 1348 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 127 FTLLSFIVEVLYIKFLIQILY 65 + LL F++ VLY+ L +Y Sbjct: 100 YYLLLFVINVLYVLTLCYAVY 120 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 257 RRDQVDCLGQWAGLSL 210 RRD+ LG W G +L Sbjct: 166 RRDKFMLLGAWLGATL 181 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 257 RRDQVDCLGQWAGLSL 210 RRD+ LG W G +L Sbjct: 166 RRDKFMLLGAWLGATL 181 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 20.2 bits (40), Expect = 9.8 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = -2 Query: 195 FTAAELFAIVLDDLDFSICPISISRCLVSLLR 100 F A ++ I +DD ++C + L+ +R Sbjct: 421 FAGAMVWTIDMDDFSGTVCGGQVKYPLIGAMR 452 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 20.2 bits (40), Expect = 9.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 357 RRRLPMQPRVNPYHKASARTTRSPT 283 RR Q +K+++RTT SPT Sbjct: 178 RRAKCRQQLQQQQNKSASRTTTSPT 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,421 Number of Sequences: 336 Number of extensions: 1603 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10721526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -