BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a01 (466 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 26 3.3 SPAC3A12.18 |zwf1|SPAC9.01|glucose-6-phosphate 1-dehydrogenase |... 25 5.7 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.8 bits (54), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 145 NLSHFYFTLLSFIVEVLYIKFLIQILYTFYHFHFNEVTLLMLI 17 NLS+F TLL + + + I Y +F N + ++M+I Sbjct: 359 NLSNFQLTLLGMGISSFALLGTVIIPYLTEYFQLNSLQVVMII 401 >SPAC3A12.18 |zwf1|SPAC9.01|glucose-6-phosphate 1-dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 25.0 bits (52), Expect = 5.7 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -2 Query: 297 TRSPT-SKIPCILGSERSSGLPW 232 +R PT S IPC + +ER G+P+ Sbjct: 313 SRCPTYSAIPCFIDTERWRGVPF 335 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,500,392 Number of Sequences: 5004 Number of extensions: 25418 Number of successful extensions: 48 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -