BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10a01 (466 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ... 28 2.7 At4g12840.1 68417.m02012 expressed protein contains Pfam profile... 28 3.6 At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 27 4.7 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 27 4.7 >At4g26120.1 68417.m03760 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 600 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -1 Query: 118 LSFIVEVLYIKFLIQI--LYTFYHFHFNEV 35 + F+VEVLY+ F+ QI L T Y F E+ Sbjct: 163 VDFMVEVLYLSFVFQIQELVTLYERQFLEI 192 >At4g12840.1 68417.m02012 expressed protein contains Pfam profile PF05212: Protein of unknown function (DUF707) Length = 413 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 136 HFYFTLLSFIVEVLYIKFLIQILYT-FYHFHFNEVTLLML 20 + + TLL + V Y + L Q++ T FY + +T+LML Sbjct: 172 NMFVTLLGGLQSVFYTRILSQLILTFFYGMKISVLTILML 211 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 89 NVQHLNNETKQREIEMGQIEKSRSS 163 N+Q +NN+ + E+E+ +I ++RS+ Sbjct: 740 NIQDVNNDPRDTEVEVKEISEARST 764 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 89 NVQHLNNETKQREIEMGQIEKSRSS 163 N+Q +NN+ + E+E+ +I ++RS+ Sbjct: 775 NIQDVNNDPRDTEVEVKEISEARST 799 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,684,732 Number of Sequences: 28952 Number of extensions: 130252 Number of successful extensions: 272 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 782033640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -