Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov12j19
         (468 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ435325-1|ABD92640.1|  160|Apis mellifera OBP7 protein.               21   6.6  
AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    21   6.6  

>DQ435325-1|ABD92640.1|  160|Apis mellifera OBP7 protein.
          Length = 160

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 6/12 (50%), Positives = 12/12 (100%)
 Frame = -2

Query: 290 KFMLIFLYIITI 255
           KF++IF+YI+++
Sbjct: 3   KFLVIFVYILSV 14


>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 10/46 (21%), Positives = 24/46 (52%)
 Frame = +3

Query: 237 EEANKINSDNVKKYQHELLPKLKDLTERVQLLSWALQQNVIDTYIN 374
           E+ +  N ++ +KY+     + +D TER +     +  ++ + YI+
Sbjct: 284 EQKSYKNENSYRKYRETSKERSRDKTERERSKERKIISSLSNNYIS 329


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,246
Number of Sequences: 438
Number of extensions: 2098
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12559158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)