BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12h14 (596 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.3 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 23 3.0 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 23 3.0 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 23 3.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 4.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 6.9 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 6.9 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 210 VRRHISKTTSVTNS 251 VR H++ T SVTNS Sbjct: 341 VRNHLNSTCSVTNS 354 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 253 MPWPRGWTSRR 285 MPW +GWT R Sbjct: 135 MPWFKGWTVER 145 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 253 MPWPRGWTSRR 285 MPW +GWT R Sbjct: 151 MPWFKGWTVER 161 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 253 MPWPRGWTSRR 285 MPW +GWT R Sbjct: 208 MPWFKGWTVER 218 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 190 INFSKLFFVENIFVVLQY 137 INF + FF+E + VL + Sbjct: 10 INFDRFFFIEGMTNVLDF 27 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 385 WL-PEDWPFPRTSPGSSWLSFRTSSGISLRLASTLMFRKPANGWLSCCNI 531 W+ PE P T +S L+ T + S + + + K + W+S C++ Sbjct: 236 WIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPPVSYVKAIDVWMSSCSV 285 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 292 DLLADWSSLGAMASELVT 239 D+ AD+ SLG + EL+T Sbjct: 543 DISADYWSLGVLMFELLT 560 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,617 Number of Sequences: 438 Number of extensions: 4018 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -