BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12h09 (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.5 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 22 3.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.7 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 4.7 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 186 NRRRMNRKQKSTGNVQCSIVKEAWNNKKTSAR 281 +RRR RKQ++ G+V+ S E+ ++ TS+R Sbjct: 1766 SRRRQQRKQQTPGDVE-SDESESDPDQLTSSR 1796 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 1.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +3 Query: 186 NRRRMNRKQKSTGNVQCSIVKEAWNNKKTSAR 281 +RRR RKQ++ G+V+ S E+ ++ TS+R Sbjct: 1762 SRRRQQRKQQTPGDVE-SDESESDPDQLTSSR 1792 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 22.2 bits (45), Expect = 3.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 228 VQCSIVKEAWNNKKTSARNLREMGLVSDPNKTIKI 332 + IV+ N+ + + L E +SDPN IKI Sbjct: 83 ISSDIVRAVLNDNEAD-QLLAECSPISDPNALIKI 116 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 404 HFFI*IDLVYHLFRPLNLSL 345 HF ID H++ PL +SL Sbjct: 990 HFISGIDSNLHVYAPLKISL 1009 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 389 IDLVYHLFRPLNLSLFE 339 ID V HLF N+SL E Sbjct: 229 IDAVPHLFESANISLDE 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,862 Number of Sequences: 438 Number of extensions: 2515 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -