BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12h07 (425 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0372 - 20013078-20013533,20013969-20014062,20014247-20014422 27 4.8 05_04_0256 - 19465636-19466709,19467649-19467765,19468168-194682... 27 8.3 >06_03_0372 - 20013078-20013533,20013969-20014062,20014247-20014422 Length = 241 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 231 KEFARFCGRCSMNTQKNALMNL 296 KEF + C RC +T KN L L Sbjct: 78 KEFIQRCARCQKHTSKNFLQEL 99 >05_04_0256 - 19465636-19466709,19467649-19467765,19468168-19468279, 19469019-19469167,19469378-19469449,19469544-19469609, 19471945-19472073,19474539-19474647,19475225-19475304, 19475408-19475533,19475607-19475657,19475738-19475920, 19476019-19476105,19476184-19476294,19476692-19476796, 19477513-19477678,19477769-19477941,19478022-19478094, 19479472-19479655,19479759-19480203 Length = 1203 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 353 KLVQQY*IISHIKSVLSI*KIHECVLLRVHGTPATESREL 234 K+V +Y SH+K + + IHE + G P T L Sbjct: 602 KIVHRYHFASHLKRMSVVVSIHEKYYAFIKGAPETIQERL 641 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,202,932 Number of Sequences: 37544 Number of extensions: 159417 Number of successful extensions: 238 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 238 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 790518168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -