BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12h07 (425 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / halo... 26 9.3 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 26 9.3 >At5g23630.1 68418.m02771 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase familiy protein similar to SP|O14072 Cation-transporting ATPase 4 (EC 3.6.3.-) {Schizosaccharomyces pombe}; contains InterPro accession IPR001757: ATPase, E1-E2 type; contains Pfam profile PF00702: haloacid dehalogenase-like hydrolase Length = 1179 Score = 26.2 bits (55), Expect = 9.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 359 TTKLVQQY*IISHIKSVLSI*KIHECVLLRVHGTPATESREL 234 + +++Q+Y SH+K + I +I E L V G P T L Sbjct: 575 SVQIMQRYHFASHLKRMSVIVRIQEEYLAFVKGAPETIQERL 616 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 26.2 bits (55), Expect = 9.3 Identities = 19/88 (21%), Positives = 35/88 (39%) Frame = -3 Query: 405 TLFQRIIVMYIYTFPYD*VSTTVLNYFAYKVRLEHLEDS*VRSFACSWNTGHRISRTLYV 226 +L + ++ ++ P + T +L +EDS V SW G +I R Sbjct: 334 SLISNCVGVFTHSLPIKCLLTGILGCSPVMTHKICVEDSSVTVLQHSWRNGWQIKRMNDT 393 Query: 225 TEYTRTDRLHFQSITYIRHVVRIKKRQS 142 + F S++ + H R +RQ+ Sbjct: 394 AHLRLFKKALFCSVSRLLHTERHTERQN 421 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,973,180 Number of Sequences: 28952 Number of extensions: 143983 Number of successful extensions: 225 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 225 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -