BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12h03 (588 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase G... 27 2.0 SPCC1739.02c |mrpl22||mitochondrial ribosomal protein subunit L2... 26 3.5 SPBP8B7.10c |||U3 snoRNP-associated protein Utp16 |Schizosacchar... 26 3.5 SPBC18A7.01 ||SPBC4F6.19c|X-Pro dipeptidase |Schizosaccharomyces... 25 8.2 SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase |Schizosacc... 25 8.2 >SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase Gde1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 27.1 bits (57), Expect = 2.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 135 FGGRRKYIMVPFKPDV 182 +GG+RKYI F PD+ Sbjct: 945 YGGKRKYIFSSFNPDI 960 >SPCC1739.02c |mrpl22||mitochondrial ribosomal protein subunit L22|Schizosaccharomyces pombe|chr 3|||Manual Length = 249 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -3 Query: 196 LVPSITSGLNGTIIYLRRPPK*YLHQFLSASMVQSQLNPHLNISNNK 56 LVPS T GLN + + P ++ +F + S ++ N+ + K Sbjct: 15 LVPSSTIGLNSKTYHYKFPLLSFVREFSNGSYLRESAQNPANLGSQK 61 >SPBP8B7.10c |||U3 snoRNP-associated protein Utp16 |Schizosaccharomyces pombe|chr 2|||Manual Length = 346 Score = 26.2 bits (55), Expect = 3.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 382 EIASLSGSYALLSNRSSVKGCPLRTTKHFFSSLVIKLYL 266 E++ S S + +KG L +T HF S L+I L+L Sbjct: 171 EVSLKSSSDEVKKRLQRLKGNELHSTAHFVSLLLIVLFL 209 >SPBC18A7.01 ||SPBC4F6.19c|X-Pro dipeptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 451 Score = 25.0 bits (52), Expect = 8.2 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = +3 Query: 423 SDGTSAAVPLLERGSETVG-LWSAVYDSQVDSHLM---VSVTAAADCMVAAWKV 572 SD T +P ++ +E + LW+ VYD+Q M +S T+ A+ +AA KV Sbjct: 315 SDCTRTVLPHGQKMTERMEKLWNLVYDAQTAGIQMLSHLSNTSCAEVDLAARKV 368 >SPAC13C5.05c |||N-acetylglucosamine-phosphate mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 518 Score = 25.0 bits (52), Expect = 8.2 Identities = 13/57 (22%), Positives = 27/57 (47%) Frame = +3 Query: 399 SDIEKRGPSDGTSAAVPLLERGSETVGLWSAVYDSQVDSHLMVSVTAAADCMVAAWK 569 SD+E S G +AA+ +E +T+G+ + V+ + + + A + W+ Sbjct: 19 SDLEAAVYSSGVAAALRSMELKGKTIGVMITASHNPVEDNGVKIIDADGGMLAMEWE 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,612,863 Number of Sequences: 5004 Number of extensions: 56056 Number of successful extensions: 133 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -