BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12g17 (574 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.1 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 6.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 6.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.6 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 6.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 8.7 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 8.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 8.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 8.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 8.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.7 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 396 LRVAPEEHPVLLTEAPLNPKANREKM 473 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 209 PLDRGKAPPSGRDGRYGTEGLVRRRRG 289 PL+RG+ SG+ Y +R R G Sbjct: 35 PLERGELTNSGKMREYQLGQFLRERYG 61 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 209 PLDRGKAPPSGRDGRYGTEGLVRRRRG 289 PL+RG+ SG+ Y +R R G Sbjct: 50 PLERGELTNSGKMREYQLGQFLRERYG 76 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 6.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE++R +P+I N + Sbjct: 291 KYGETSKERSRDRTERERSKEPKIISSLSNNY 322 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 159 GMCKAGFAGD 188 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 58 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 89 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 58 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 89 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 58 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 89 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 58 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 89 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 291 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 322 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 291 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 322 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 291 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 322 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 291 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 322 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 291 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 322 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +2 Query: 251 RYGTEGLVRRRRGTEQKRYPDPQIPHRTRNRH 346 +YG R R TE+++ +P+I N + Sbjct: 280 KYGETSKERSRNRTEREKSKEPKIISSLSNNY 311 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 218 DRGEHGARSIISCETGLA 165 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 218 DRGEHGARSIISCETGLA 165 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,725 Number of Sequences: 438 Number of extensions: 4208 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -