BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12g12 (566 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.0 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 7.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.7 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.8 bits (49), Expect = 1.0 Identities = 9/44 (20%), Positives = 20/44 (45%) Frame = +2 Query: 203 MNKLNLLWTKAQQRLTEPKLKSLYSDLMLHDKEEITYKRFKSDG 334 +NK +WT+ +++ + Y L ++ + K F +G Sbjct: 279 LNKTKPIWTRNADDISQEEYGEFYKSLTNDWEDHLAVKHFSVEG 322 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.0 bits (42), Expect = 7.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 448 VIFLSICLRIKMLQ*TIDRHDVT 380 +IFL I R +M+ I R DVT Sbjct: 107 LIFLLIQTRFEMINNIITRGDVT 129 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.7 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 322 KPFVCNFFF 296 +PFVCN+ F Sbjct: 343 RPFVCNWLF 351 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,944 Number of Sequences: 336 Number of extensions: 2192 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -