BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12g05 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 3.5 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 22 4.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 4.7 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 6.2 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.2 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 3.5 Identities = 8/38 (21%), Positives = 15/38 (39%) Frame = +1 Query: 373 YYSFNPLTNTTNLFLPIFIYSVTKIIWFPPKDNSNTTN 486 Y S + + + + P+F ++ WF S N Sbjct: 417 YNSVSKIDRASRIVFPLFFLAINVFYWFAYLSRSERIN 454 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 43 LTGKSADSCARGSPVRTVD 99 LT K +C R SPV T++ Sbjct: 24 LTAKLLGNCVRVSPVITIE 42 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 144 ILMSCCSWNLDIL 106 ++MSCC W D L Sbjct: 7 VVMSCCCWCCDNL 19 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +1 Query: 172 IVSDHTSQEPLT--IFGPETAAGDGEPV 249 +V D +S + + I GP T GD +PV Sbjct: 353 LVQDISSPDAVEYGIIGPTTCMGDHKPV 380 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = +1 Query: 166 DSIVSDHTSQEPLTIFGPETAAGDGEPVDDPSP 264 D I+ + + PLT +T +P + P P Sbjct: 154 DEIIERNGDKPPLTYHQFQTVVASMDPPEPPVP 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.132 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,916 Number of Sequences: 438 Number of extensions: 3152 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -