BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12g04 (360 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 29 1.1 SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) 28 2.0 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 27 6.1 SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) 26 8.0 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 29.1 bits (62), Expect = 1.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 157 RLWRSEHFSLLGGKKGRFPHRTELKARIGEDSSRT*CSGKIIL 285 +LW F + G KKG FP+ ++ R+ + + CS +IL Sbjct: 1080 QLWLLSRFKINGTKKGCFPYNKQIFWRLNKVKKKE-CSHTVIL 1121 >SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) Length = 337 Score = 28.3 bits (60), Expect = 2.0 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -2 Query: 257 LLLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 153 L L+ + A+ V W +L FLPP++ + D HN++ Sbjct: 128 LQLAGAVIAVLFVAWLSLKFLPPTR-RVGDYHNKY 161 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 27.5 bits (58), Expect = 3.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 6 RFQSVPCKVFHHNHCRF 56 RF S+ C +FH NH F Sbjct: 512 RFLSITCPIFHRNHVTF 528 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 26.6 bits (56), Expect = 6.1 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -2 Query: 302 KYYFANKIIFPL---HYVLLLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 153 +Y ++FP+ H V+ +S P SS + PPS + R +RH Sbjct: 316 RYLHVTALVFPITIVHLVIFMSPPSSFQSSPSVSSSSLSPPSSFQSYHRPSRH 368 >SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) Length = 939 Score = 26.2 bits (55), Expect = 8.0 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -2 Query: 317 QACTRKYYFANKIIFPLHYVLLLSSPIRALSSVRWGNLPFLPPSKEKCSD 168 Q C Y + +IFP Y L + LS R N + P +KC D Sbjct: 787 QKCLEAYLESKCVIFPRFYFLSNDELLEILSQTR--NPHAVQPHLQKCFD 834 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,687,046 Number of Sequences: 59808 Number of extensions: 209263 Number of successful extensions: 415 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 572951758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -