BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12g03 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 3.0 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 24 5.3 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 23 7.0 AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 23 7.0 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 7.0 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/55 (25%), Positives = 24/55 (43%) Frame = +1 Query: 187 TKNIANEPTWKILIYDRVGQDIISPLVSVKDLRELGVTLHLQLHSDRDSIPEVPA 351 ++ I TW ++ + R ++I+ V D G HL H + S + PA Sbjct: 243 SREIVRPDTWSVIPFSRSDHELIAFEVKQPDENPAGAQQHLS-HRPQRSTRKNPA 296 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 426 IPFKLYITNHKTQT*RLSCISYPVKFCCQY 515 +PF +YI SC P +F C+Y Sbjct: 148 VPFCVYIQGSTMSWVATSCDDEPRQFICEY 177 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 429 PFKLYITNHKTQT*RLSCISYPVKFCCQY 515 PF +YI SC P +F C+Y Sbjct: 137 PFCVYIQGSTMSWVATSCXDEPRQFICEY 165 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = +2 Query: 341 KYLLFISVLLLMKIWIAFAKISI 409 KYLLF +L+ + +W +++ Sbjct: 310 KYLLFTMILVSLSVWTTVCVLNV 332 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 7.0 Identities = 18/68 (26%), Positives = 29/68 (42%) Frame = +1 Query: 217 KILIYDRVGQDIISPLVSVKDLRELGVTLHLQLHSDRDSIPEVPAVYFCSPSDENLDRIC 396 KI YDR+ Q I + ++ EL L L D D A+ + +++D Sbjct: 205 KIKPYDRIPQIFICATMWHENKEELMEFLKSILRLDEDQCARRMAMKHIQANKDDIDPDY 264 Query: 397 QDLDNGIY 420 DL+ I+ Sbjct: 265 YDLETHIF 272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,647 Number of Sequences: 2352 Number of extensions: 13113 Number of successful extensions: 53 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -