BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f23 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 0.86 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 0.86 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 0.86 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 26 0.86 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.5 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 25 2.0 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 2.0 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 2.0 AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding pr... 25 2.0 AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding pr... 25 2.0 AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine pr... 25 2.0 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 3.5 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 4.6 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 6.1 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 6.1 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 6.1 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 23 8.0 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 23 8.0 AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 23 8.0 AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-l... 23 8.0 AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 23 8.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 0.86 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 477 KVNSLESEEQQERHHKTEQTHSFRQGETQ 391 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 0.86 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 477 KVNSLESEEQQERHHKTEQTHSFRQGETQ 391 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 0.86 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 477 KVNSLESEEQQERHHKTEQTHSFRQGETQ 391 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 192 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 220 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 25.8 bits (54), Expect = 0.86 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = -1 Query: 477 KVNSLESEEQQERHHKTEQTHSFRQGETQ 391 ++ L+ ++QQ+ HH+ +Q S Q ++Q Sbjct: 240 QLERLQQQQQQQTHHQQQQHPSSHQQQSQ 268 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 201 RELCRDSRYHLCMGGY-CCKWSHQC 130 ++LC +++ L MGG+ KW+ C Sbjct: 882 KQLCEETKAALAMGGFPLRKWASNC 906 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 24.6 bits (51), Expect = 2.0 Identities = 19/57 (33%), Positives = 26/57 (45%) Frame = -1 Query: 288 SHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSRYHLCMGGYCCKWSHQCRVAE 118 S+CR T+ R N L RCGL G R +++ LC G + S R A+ Sbjct: 519 SNCRSTA-----DRQN-LCIRCGLTGHKARSCQNEAKCALCGGAHHIGHSECARSAQ 569 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 Query: 318 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 178 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 Query: 318 CSNTSSGTSYSHCRCTSTNEFGSRVNVLSDRCGLEGPHCRELCRDSR 178 C+ ++ T +SHC+C + G +L+ + GP ++C + R Sbjct: 183 CTPNATNTVWSHCQCVLAD--GVERGILTVNRMIPGPSI-QVCENDR 226 >AY330180-1|AAQ16286.1| 176|Anopheles gambiae odorant-binding protein AgamOBP54 protein. Length = 176 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 333 EGAEDCSNTSSGTSYSHCRCTSTNE 259 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >AJ618924-1|CAF02003.1| 144|Anopheles gambiae odorant-binding protein OBP5470 protein. Length = 144 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 333 EGAEDCSNTSSGTSYSHCRCTSTNE 259 +GAEDCS++ TS H + T E Sbjct: 14 DGAEDCSSSVDETSEPHDKMMCTLE 38 >AF393486-1|AAL60411.1| 162|Anopheles gambiae twelve cysteine protein 1 protein. Length = 162 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 333 EGAEDCSNTSSGTSYSHCRCTSTNE 259 +GAEDCS++ TS H + T E Sbjct: 51 DGAEDCSSSVDETSEPHDKMMCTLE 75 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 3.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 110 LPSSATLHWCDHLQQYPPIHRWYLLSLHSSLQCGPSRPH 226 LP SAT W Q+ P H ++ SS Q PH Sbjct: 19 LPYSATTGWYPSNYQHQPPHPQFIGDGESSPQPAMYYPH 57 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 4.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 132 CRVAEDGRPGCRGDQSG 82 C E G+ CRGD G Sbjct: 304 CAGGEKGKDSCRGDSGG 320 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = +3 Query: 270 WCSDSGSSWFRSWYWNSLRLPH 335 WCS G+ W+ + R H Sbjct: 70 WCSTDGAHGLMLWFCRTARTKH 91 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = -1 Query: 462 ESEEQQERHHKTEQTHSFRQGETQNGV 382 + ++QQ++ + +Q H Q + QN + Sbjct: 901 QHQQQQQQQQQQQQQHEHEQQQQQNSM 927 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 6.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 210 PHCRELCRDSRYH 172 P CR +C D+R H Sbjct: 858 PICRAICEDTRVH 870 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 22.6 bits (46), Expect = 8.0 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -1 Query: 138 HQCRVAEDGRPGCRGDQSG 82 H C + + G C GD G Sbjct: 196 HLCTLTKTGEGACNGDSGG 214 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 22.6 bits (46), Expect = 8.0 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -1 Query: 138 HQCRVAEDGRPGCRGDQSG 82 H C + + G C GD G Sbjct: 196 HLCTLTKTGEGACNGDSGG 214 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 22.6 bits (46), Expect = 8.0 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 155 YPPIHRWY 178 YP +HRWY Sbjct: 183 YPNVHRWY 190 >AF457556-1|AAL68786.1| 65|Anopheles gambiae salivary gland 7-like protein protein. Length = 65 Score = 22.6 bits (46), Expect = 8.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 174 GTCCPYTALCSAVLP 218 G CCP+ L +A LP Sbjct: 21 GLCCPWIDLAAADLP 35 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 22.6 bits (46), Expect = 8.0 Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = -1 Query: 417 HSFRQGETQNGV*EQLLLEGGVPGIA-DDEGAEDCSNTSSGTSYSHCRCTST 265 H+ R+ + G + L +P + D+E A+ N + Y H C +T Sbjct: 71 HNTRRSQLALGQLKPFLPAVRMPTLTWDEELAKQAGNNARSCQYQHDSCRNT 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 545,450 Number of Sequences: 2352 Number of extensions: 11296 Number of successful extensions: 51 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -