BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f22 (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 30 0.054 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 25 1.2 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 25 2.0 AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical prote... 25 2.0 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 24 2.7 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 4.7 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 4.7 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 4.7 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 29.9 bits (64), Expect = 0.054 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 282 EKVVSVEPCKCNKQYSKEINTENKLSRDLKESLKKIWRLRTKI 410 +K + E NKQ +I+ +NKL DLK+ + K L KI Sbjct: 392 DKWIQGELKSLNKQIKDKISHQNKLQDDLKKDIAKQGELEKKI 434 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 96 DVVRRQLTMKNHSATHALNHSLLKVL 121 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 96 DVVRRQLTMKNHSATHALNHSLLKVL 121 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 97 DVVRRQLTMKNHSATHALNHSLLKVL 122 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 96 DVVRRQLTMKNHSATHALNHSLLKVL 121 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 96 DVVRRQLTMKNHSATHALNHSLLKVL 121 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 80 DVVRRQLTMKNHSATHALNHSLLKVL 105 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +VVR T +N ++ HAL H+L VL Sbjct: 110 DVVRRQLTMKNHSATHALNHSLLKVL 135 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 316 LHLQGSTLTTFSPGTSTRSVILIIVHCSL 230 L G+ +T +PG + +V +IIV+C L Sbjct: 58 LDKNGTEVTITAPGHTDSTVAVIIVYCVL 86 >AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical protein 11 protein. Length = 56 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 135 LFDVLILLFFYNLFCKTVY 79 L +LI LFFY+ C T Y Sbjct: 11 LLVLLICLFFYHTHCTTAY 29 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 97 DVMRRQLTMKNHSATHALNHSLLKVL 122 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 80 DVMRRQLTMKNHSATHALNHSLLKVL 105 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 14 NVVRGSRTARNTASPHALLHALYTVL 91 +V+R T +N ++ HAL H+L VL Sbjct: 110 DVMRRQLTMKNHSATHALNHSLLKVL 135 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/48 (18%), Positives = 21/48 (43%) Frame = +3 Query: 273 VPGEKVVSVEPCKCNKQYSKEINTENKLSRDLKESLKKIWRLRTKITV 416 VPG ++ C ++++ + T+ L + + W L++ V Sbjct: 724 VPGSDYINANYCDGYRKHNAYVATQGPLQETFGDFWRMCWELKSSTIV 771 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 16 RCSWQPYCAQHSIAARAPTCT 78 R SW+P H+ + PT T Sbjct: 696 RPSWRPLIVPHATTTKTPTTT 716 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 16 RCSWQPYCAQHSIAARAPTCT 78 R SW+P H+ + PT T Sbjct: 695 RPSWRPLIVPHATTTKTPTTT 715 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,363 Number of Sequences: 2352 Number of extensions: 10432 Number of successful extensions: 69 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -