BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmov12f20
(331 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q7P2Z8 Cluster: Putative uncharacterized protein FNV194... 34 0.69
>UniRef50_Q7P2Z8 Cluster: Putative uncharacterized protein FNV1941;
n=1; Fusobacterium nucleatum subsp. vincentii ATCC
49256|Rep: Putative uncharacterized protein FNV1941 -
Fusobacterium nucleatum subsp. vincentii ATCC 49256
Length = 637
Score = 33.9 bits (74), Expect = 0.69
Identities = 18/48 (37%), Positives = 24/48 (50%)
Frame = +1
Query: 184 YQTNGYTQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINPNE 327
Y NG +L NTY K + + +N + NN Y ISSIN N+
Sbjct: 228 YDNNGNLELENTYKNGKLVDTKEYDIEKNILNKNNNY---ISSINNNQ 272
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 272,100,931
Number of Sequences: 1657284
Number of extensions: 4113893
Number of successful extensions: 8708
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8533
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8707
length of database: 575,637,011
effective HSP length: 86
effective length of database: 433,110,587
effective search space used: 9961543501
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -