BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f20 (331 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.13 |rba50||RNA polymerase II associated protein |Schizos... 27 0.73 SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch... 25 3.0 SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ... 24 5.2 SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 24 5.2 SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosacc... 23 9.0 SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 23 9.0 SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomy... 23 9.0 >SPBC947.13 |rba50||RNA polymerase II associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 27.1 bits (57), Expect = 0.73 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 199 YTQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINPNEI 330 Y QL + Y P+ + Q+ + + N Y P + S++ +EI Sbjct: 281 YEQLHDKYFPNLPVDEKQMQWLHDPSPAENSYHPSVESLHAHEI 324 >SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1316 Score = 25.0 bits (52), Expect = 3.0 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = +1 Query: 187 QTNGYTQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINPNEI 330 Q +GY + +T TP+ P + Q+ + + + S++P E+ Sbjct: 389 QVDGYDEPLSTTTPTLIEPIQETLMTQSPIIECEPFNTVKPSVSPEEV 436 >SPBP23A10.14c |ell1||RNA polymerase II transcription elongation factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 24.2 bits (50), Expect = 5.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 211 SNTYTPSKNIPCNQLATAQNYVASNN 288 S T TPS N+P +Q + + +Y N Sbjct: 166 SPTNTPSPNLPVSQPSASPHYSGDKN 191 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 24.2 bits (50), Expect = 5.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 253 LATAQNYVASNNQYQPLIS 309 L + NY+ S+N YQP +S Sbjct: 141 LCASLNYIDSSNTYQPQLS 159 >SPAC56E4.06c |ggt2||gamma-glutamyltranspeptidase Ggt2|Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 220 YTPSKNIPCNQLATAQNYVASNNQYQPLISSIN 318 Y PS ++P + T + V SNN + S++N Sbjct: 408 YNPSYDLPISHGTTHVSTVDSNNLAVSITSTVN 440 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/45 (24%), Positives = 18/45 (40%) Frame = +1 Query: 187 QTNGYTQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINP 321 ++N ++ Y P + L NY S P IS++ P Sbjct: 425 RSNSTGKIGKNYRPRRTYSGRLLCGPNNYEVSTIMRSPTISTVPP 469 >SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 573 Score = 23.4 bits (48), Expect = 9.0 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 277 LHNFEL*LVGYKGCFWMACKC 215 L NF ++GY W+ C C Sbjct: 503 LFNFLTSIIGYGNVMWIFCGC 523 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,176,447 Number of Sequences: 5004 Number of extensions: 18836 Number of successful extensions: 50 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 91899990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -