BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f18 (611 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC119287-1|AAO38568.1| 218|Caenorhabditis elegans Glutathione s... 30 1.1 Z93379-1|CAB07589.1| 218|Caenorhabditis elegans Hypothetical pr... 30 1.5 AC006723-1|AAF59429.3| 534|Caenorhabditis elegans Hypothetical ... 27 8.0 >AC119287-1|AAO38568.1| 218|Caenorhabditis elegans Glutathione s-transferase protein34 protein. Length = 218 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 3/73 (4%) Frame = +3 Query: 297 EDETKQVHDKMNVKHHSPVYSVIMKLKKEVDINH--GDSVVWKNIEMASGPNSPVQ-TEQ 467 E+E K++HD++ + + ++ ++ ++ KE + GD + W ++ +A S E Sbjct: 124 EEEVKRIHDEVYIPVKNLLFKILTRILKESKSEYLVGDGLTWADLVVADHLYSLTNIKEL 183 Query: 468 DIEDIFGDSLKTW 506 D ED +LK + Sbjct: 184 DPEDPIHLNLKKY 196 >Z93379-1|CAB07589.1| 218|Caenorhabditis elegans Hypothetical protein F21H7.1 protein. Length = 218 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +3 Query: 300 DETKQVHDKMNVKHHSPVYSVIMKLKKEVDINH--GDSVVWKNIEMA 434 +E KQ+HDK+ + + ++ ++ ++ KE GD + W ++ +A Sbjct: 125 EEVKQIHDKVYIPAKNLMFKILTRILKENKSGFLVGDGLTWADLVVA 171 >AC006723-1|AAF59429.3| 534|Caenorhabditis elegans Hypothetical protein Y19D10B.2 protein. Length = 534 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 411 VWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWDHFTD 521 V+ N+E+ GPNS + T + IE IFG + + TD Sbjct: 135 VFGNVEI--GPNSNLDTMKSIEIIFGSLIINETNLTD 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,420,818 Number of Sequences: 27780 Number of extensions: 194074 Number of successful extensions: 557 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -