BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f17 (360 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0812 + 23383704-23384143,23384902-23385247 168 1e-42 01_06_1191 - 35297005-35297473,35297812-35298965 28 1.9 04_01_0618 - 8094991-8097288 28 2.5 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 28 2.5 08_01_0397 - 3509186-3510291,3510322-3512335 27 5.9 07_03_1564 + 27749899-27750166,27750431-27750507,27750923-277509... 26 7.7 >12_02_0812 + 23383704-23384143,23384902-23385247 Length = 261 Score = 168 bits (408), Expect = 1e-42 Identities = 75/103 (72%), Positives = 88/103 (85%) Frame = +2 Query: 50 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAV 229 MGRVIRAQRKGAGSVF SHT RKG + RSLD+ ER+GY+KGVV DIIHDPGRGAPLA Sbjct: 1 MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAK 60 Query: 230 VHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEXGNVMP 358 V FR P+++K +KELF+A EG+YTGQFVYCG++ATL GNV+P Sbjct: 61 VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIGNVLP 103 >01_06_1191 - 35297005-35297473,35297812-35298965 Length = 540 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 8/61 (13%) Frame = -3 Query: 331 CFLSTINKLACVEPFGSNEELLPCLELVWI---AEVYNS-----QGCTSTRVMDYILNNS 176 C+++T++ L C+ F SN + L ++ A+VY S G +++ Y+L N+ Sbjct: 116 CWINTVSYLLCINNFASNSRVAVSLATSYLGLSAKVYTSLAETFPGLANSKTKTYLLLNA 175 Query: 175 L 173 + Sbjct: 176 V 176 >04_01_0618 - 8094991-8097288 Length = 765 Score = 27.9 bits (59), Expect = 2.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 241 RSIQVQDKEGALHCSRRALHRPICLLW 321 R Q+ D++ + C+ R +P CLLW Sbjct: 434 RRNQMVDQQSVIWCAARMTKKPNCLLW 460 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 27.9 bits (59), Expect = 2.5 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 301 CVEPFGSNEELLPCLELVWIAEVYNSQGCTSTR 203 CVE + LLP LE V+++ + +S+GCTS + Sbjct: 92 CVER--KDARLLPELEQVYLSLIASSRGCTSVQ 122 >08_01_0397 - 3509186-3510291,3510322-3512335 Length = 1039 Score = 26.6 bits (56), Expect = 5.9 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 50 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAER 160 +GR RA RKG F+S ++R +++L+ +E+ Sbjct: 749 VGRTGRAGRKGFAVTFISEEEERYAPDLVKALELSEQ 785 >07_03_1564 + 27749899-27750166,27750431-27750507,27750923-27750950, 27751117-27751261,27751351-27751429,27751515-27751633, 27751732-27752073,27754807-27754896,27755730-27755955, 27756398-27756784,27757176-27757496 Length = 693 Score = 26.2 bits (55), Expect = 7.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 211 RCTLGCCTLPRSIQVQDKEGALHCSRRAL 297 R LGCC L RS ++ +E L C + L Sbjct: 255 RAELGCCLLHRSGRLTIEECLLQCEQNPL 283 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,479,213 Number of Sequences: 37544 Number of extensions: 182777 Number of successful extensions: 393 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 554421256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -