BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f16 (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_7151| Best HMM Match : TCP (HMM E-Value=0.92) 29 2.5 SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) 29 2.5 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 28 4.4 SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_28792| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_47026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/77 (31%), Positives = 35/77 (45%) Frame = +2 Query: 53 TSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVPPSATSTFSHGQGDE 232 T+ P+N G + S P G T ++ P P G VPP+ + S+G Sbjct: 103 TTVPYN-----GPTVPSNGTTVPSNGTTVPYNG-PTVPSNGA-TVPPNGATVPSNGT--- 152 Query: 233 PKATNGTSVATNGQSTP 283 +NGT+V TNG + P Sbjct: 153 TVPSNGTTVPTNGTTVP 169 >SB_7151| Best HMM Match : TCP (HMM E-Value=0.92) Length = 188 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 188 PPSATSTFSHGQGDEPKATNGTSVATNGQSTP 283 PPS++S G+ TNG S NG++TP Sbjct: 103 PPSSSSLPELSSGNTHGETNGMSAKVNGRNTP 134 >SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) Length = 822 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 188 PPSATSTFSHGQGDEPKATNGTSVATNGQSTP 283 PPS++S G+ TNG S NG++TP Sbjct: 775 PPSSSSLPELSSGNTHGETNGMSAKVNGRNTP 806 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 107 VLRPPGGGHTNIFDSEPEPPRTGRRAVPPSAT 202 V P F E EPP+ R+ PPS T Sbjct: 318 VTTSPSNARRRFFGFETEPPQASRQCSPPSRT 349 >SB_32383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1850 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/55 (29%), Positives = 21/55 (38%) Frame = +2 Query: 86 GARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVPPSATSTFSHGQGDEPKATNG 250 G ++ PP GG + P G VP +AT G P AT+G Sbjct: 919 GGNETAPTATPPSGGGNETAPTATPPSGVGNETVP-TATPPSGSGNETAPTATSG 972 >SB_28792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 119 PGGGHTNIFDSEPEPPRTGRR-AVPPSATSTFSHGQGDEPKATNGTSVATNGQST 280 P H D P P R +PP + +T G E AT G ++++ T Sbjct: 134 PSDSHATRDDGMPPDPHATRDDGMPPDSHATRDDGMPSESHATRGDGMSSDSHVT 188 >SB_5862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2353 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 146 DSEPEPPRTGRRAVPPSATSTF 211 + EP PPRT R+ PPS +S + Sbjct: 2020 EREPLPPRTKMRSRPPSMSSIY 2041 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,007,074 Number of Sequences: 59808 Number of extensions: 271349 Number of successful extensions: 935 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 927 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -