BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f16 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02970.1 68416.m00292 phosphate-responsive 1 family protein s... 30 0.89 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 28 4.8 At5g54290.1 68418.m06762 cytochrome c biogenesis protein family ... 27 6.3 At4g19515.1 68417.m02871 disease resistance family protein simil... 27 6.3 At1g06070.1 68414.m00636 bZIP transcription factor, putative (bZ... 27 8.3 >At3g02970.1 68416.m00292 phosphate-responsive 1 family protein similar to phi-1 (phosphate-induced gene) [Nicotiana tabacum] GI:3759184; contains Pfam profile PF04674: Phosphate-induced protein 1 conserved region Length = 332 Score = 30.3 bits (65), Expect = 0.89 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 47 KMTSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVPPSATSTF-SHG 220 K +TP+N + SS + P T +F S P TGR V P F SHG Sbjct: 251 KSETTPYNDDVKKNHESSSMYIVDPATKCTRVFGSGAFPGFTGRIRVDPITGGAFNSHG 309 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 27.9 bits (59), Expect = 4.8 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 60 HHSTLASMTELVYQAGCS-APPVVATLTSSIPNRSHRGPGAVPFHQAQRALSATD 221 HH +S + LVY + S APP+ L+SS S P VP + + +A + Sbjct: 223 HHQRFSSPSFLVYPSNSSFAPPLQGVLSSS--TESEAVPQQVPAAEGEATTTAPE 275 >At5g54290.1 68418.m06762 cytochrome c biogenesis protein family low similarity to cytochrome c biogenesis protein CcdA [Paracoccus pantotrophus] GI:11095328; contains Pfam profile PF02683: Cytochrome C biogenesis protein transmembrane region Length = 354 Score = 27.5 bits (58), Expect = 6.3 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -1 Query: 240 AFGSSPC--PWLKVLVALGGTARRPVLGGS 157 A +SPC P L L+ T+R PV+GGS Sbjct: 261 ALAASPCSTPVLATLLGYVATSRDPVIGGS 290 >At4g19515.1 68417.m02871 disease resistance family protein similar to downy mildew resistance protein RPP5 [Arabidopsis thaliana] GI:6449046; contains Pfam profile PF01582: TIR domain Length = 524 Score = 27.5 bits (58), Expect = 6.3 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 75 PTLNGVEVILFFYLSLHTSLLFDG 4 P +N + +FF L +H S+LF+G Sbjct: 65 PKINDDHMFVFFDLKMHPSILFEG 88 >At1g06070.1 68414.m00636 bZIP transcription factor, putative (bZIP69) similar to transcriptional activator RF2a GB:AF005492 GI:2253277 from [Oryza sativa]; contains Pfam profile PF00170: bZIP transcription factor Length = 423 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 194 SATSTFSHGQGDEPKATNGTSVATNGQSTP 283 SATST G+ EP N + +N QSTP Sbjct: 125 SATSTSQMGEPSEPTWRNELASTSNLQSTP 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,575,388 Number of Sequences: 28952 Number of extensions: 198499 Number of successful extensions: 642 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -