BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f14 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 24 2.9 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 2.9 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 2.9 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 6.6 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 6.6 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 8.8 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 377 LIFTVGVSAASLLGCVIWEYENLRVHASSLLRRPGTWLTA 496 L+F VG + A + V +EY +R +S+ PG + A Sbjct: 8 LLFFVGQTVAYTIPAVRFEYPTMRGFRASIPDTPGLQMFA 47 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 377 LIFTVGVSAASLLGCVIWEYENLRVHASSLLRRPGTWLTA 496 L+F VG + A + V +EY +R +S+ PG + A Sbjct: 8 LLFFVGQTVAYTIPAVRFEYPTMRGFRASIPDTPGLQMFA 47 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 377 LIFTVGVSAASLLGCVIWEYENLRVHASSLLRRPGTWLTA 496 L+F VG + A + V +EY +R +S+ PG + A Sbjct: 8 LLFFVGQTVAYTIPAVRFEYPTMRGFRASIPDTPGLQMFA 47 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 377 LIFTVGVSAASLLGCVIWEYENLRVHASSLLRRPGTWLTA 496 L+F VG + A + + +EY +R +S+ PG + A Sbjct: 8 LLFFVGQTVAYTIPALRFEYPTMRGFRASIPDTPGLQMFA 47 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 377 LIFTVGVSAASLLGCVIWEYENLRVHASSLLRRPGTWLTA 496 L+F VG + A + + +EY +R +S+ PG + A Sbjct: 8 LLFFVGQTVAYTIPALRFEYPTMRGFRASIPDTPGLQMFA 47 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 368 VKPLIFTVGVSAASLLGCVIW 430 +K + T GV S+LG +W Sbjct: 592 IKKMSLTAGVPQGSILGPTLW 612 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,873 Number of Sequences: 2352 Number of extensions: 10181 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -