BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f14 (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 26 0.22 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 26 0.29 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 23 2.7 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 2.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 3.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 22 4.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 4.7 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.7 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.7 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 6.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 6.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 6.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 6.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 6.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.2 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 6.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 8.2 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 8.2 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 8.2 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.2 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.2 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 8.2 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 8.2 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 8.2 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 8.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 8.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 8.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 8.2 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 8.2 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 8.2 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 8.2 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 8.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.2 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 26.2 bits (55), Expect = 0.22 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVAS--SET*PFGKST-Y*NWPVTCER 363 +RKY +T+ +S ERS +P IS + S + + K Y N+ + E+ Sbjct: 56 YRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNYNKKLYYKNYIINIEQ 115 Query: 364 ISETAYFYCGS 396 I YCG+ Sbjct: 116 IPVPVPIYCGN 126 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 25.8 bits (54), Expect = 0.29 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 540 HFFNGPGSDLLFFCCAVSHVPGLRSSEEA*TRRFSYSHITQPSKLAA 400 H+F GS +F +S EEA TR ITQ +K A Sbjct: 298 HYFTKYGSGECYFSSDLSESETSSDEEEADTRPLKKEPITQSNKRTA 344 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 22.6 bits (46), Expect = 2.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 293 SWQALKPDPLENLHIETGPLHAKGLVKPLIFTVGVSAASLL 415 SW+ DP+ N G L GL+ P +FT+ S A+++ Sbjct: 52 SWEV--HDPVTNSDTYIGFLFVLGLIVP-VFTIVSSYAAIV 89 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 245 KNGRLIRNSFHNSKRGSWQALKPDPLENL 331 KNG L +NS G W +P EN+ Sbjct: 314 KNGVLFFGLMNNSAIGCWNEHQPLQRENM 342 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 3.6 Identities = 14/58 (24%), Positives = 28/58 (48%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASSET*PFGKSTY*NWPVTCERI 366 +RKY +T +S + ERS +P IS R + ++ + + N+ C+++ Sbjct: 56 YRKYRETWKERSRDRTERERSREPKIISSLSNRTIHNNNNYKYNYNNN-NYNNNCKKL 112 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNNY 89 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNKTI 90 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNKTI 90 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASS 306 +RKY +T+ +S ERS +P IS + S+ Sbjct: 289 YRKYRETSKERSRDRKERERSKEPKIISSLSNNYKYSN 326 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + + Sbjct: 289 YRKYRETSKERSRDRTERERSREPKIISSLSNKTI 323 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRKTSKERSRDRTERERSKEPKIISSLSNNY 89 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRKERERSKEPKIISSLSNKTI 90 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRKERERSKEPKIISSLSNKTI 90 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRKERERSKEPKIISSLSNKTI 90 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S ERS +P IS + + Sbjct: 56 YRKYRETSKERSRDRKERERSKEPKIISSLSNKTI 90 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 6.2 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASS 306 +RKY +T+ +S + ERS +P IS + S+ Sbjct: 289 YRKYGETSKERSRDRTERERSKEPKIISSLSNNYKYSN 326 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S ERS +P IS + + Sbjct: 289 YRKYRETSKERSRDRKERERSKEPKIISSLSNKTI 323 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRF 294 +RKY +T+ +S ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRRERERSKEPKIISSLSNNY 89 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 55 YRKYRETSKERSRDRTERERSREPKIISSLSNNTI 89 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 55 YRKYRETSKERSRDRAERERSREPKIISSLSNNTI 89 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNNTI 90 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNNTI 90 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNNTI 90 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFV 297 +RKY +T+ +S + ERS +P IS + Sbjct: 56 YRKYRETSKERSRDRTERERSREPKIISSLSNNTI 90 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 8.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASSET*PFGKSTY*NWPVTCERI 366 +RKY +T +S + ERS +P IS + + ++ + + N+ C+++ Sbjct: 56 YRKYRETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNN-NYNNNCKKL 112 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 8.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASSET*PFGKSTY*NWPVTCERI 366 +RKY +T +S + ERS +P IS + + ++ + + N+ C+++ Sbjct: 56 YRKYRETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNN-NYNNNCKKL 112 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 21.0 bits (42), Expect = 8.2 Identities = 13/58 (22%), Positives = 28/58 (48%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FISQFKKRFVASSET*PFGKSTY*NWPVTCERI 366 +RKY +T +S + ERS +P IS + + ++ + + N+ C+++ Sbjct: 56 YRKYRETWKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNN-NYNNNCKKL 112 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 56 YRKYRETSKERSRNRTERERSKEPKIIS 83 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 289 YRKYRETSKERSRNRTERERSKEPKIIS 316 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 8.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 193 FRKYLQTTTIQSSLAST*ERSIDP*FIS 276 +RKY +T+ +S + ERS +P IS Sbjct: 289 YRKYRETSKERSRNRTERERSKEPKIIS 316 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 245 KNGRLIRNSFHNSKRGSWQALKPDPLENL 331 KNG L +NS G W +P +N+ Sbjct: 314 KNGVLFFGLVNNSAIGCWNEHQPLQRQNM 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,826 Number of Sequences: 438 Number of extensions: 3169 Number of successful extensions: 56 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -