BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f13 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 24 5.1 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 8.9 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.8 bits (49), Expect = 5.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 61 DVKNAFYVGNYQQAINEAQSVSPSTPLVALQRDAF 165 DVKNAF N+Q + Q+ L + R F Sbjct: 630 DVKNAFNTANWQSIASRLQAKGVPVGLQRMLRSYF 664 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 8.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 543 RQSAVIFNVLQQLQLFACKVWSIHSQ*ALECERS*FQRFS 424 +Q+ V++ LQQL + W Q ECE+ QR S Sbjct: 132 QQTDVLYG-LQQLHVMERNNWKETHQLIQECEQDHVQRLS 170 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,709 Number of Sequences: 2352 Number of extensions: 13284 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -