BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f11 (277 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 20 4.9 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 19 8.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 19 8.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 20.2 bits (40), Expect = 4.9 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -1 Query: 133 SVYHKPE-ENPPGGTLTRL 80 +V+ K E ++P GG LTRL Sbjct: 660 AVHIKQEGQSPEGGKLTRL 678 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 19.4 bits (38), Expect = 8.6 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +2 Query: 98 PRRVLLGLVVNRTTPVGCESVQSNLRFSFNSHYVTNMYRG 217 P ++ GL+ P + + L S N VTN Y G Sbjct: 638 PSHIMAGLLDKFFFPKWLQVLALWLNHSPNYDQVTNWYMG 677 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 19.4 bits (38), Expect = 8.6 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = +2 Query: 116 GLVVNRTTPVGCESVQSN 169 G+++ P+GCE N Sbjct: 424 GVIIPDDPPIGCECKTCN 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,005 Number of Sequences: 438 Number of extensions: 967 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 5388717 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -