BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f10 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.08c |fft1||fun thirty related protein Fft1|Schizosaccha... 27 2.0 SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Sch... 27 3.4 SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom... 26 4.5 SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces p... 26 6.0 SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 26 6.0 SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosac... 25 7.9 >SPAC20G8.08c |fft1||fun thirty related protein Fft1|Schizosaccharomyces pombe|chr 1|||Manual Length = 944 Score = 27.5 bits (58), Expect = 2.0 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +3 Query: 336 EEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYVREFGPEEMKAVMTAKDV 503 EE ED G + CT + N + + D +E + GP E++ M+ DV Sbjct: 220 EETNEDDLLGQS-PTACTTDANIDNSIPENSDKIEEVSIESSGPSEVEDEMSEYDV 274 >SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Schizosaccharomyces pombe|chr 2|||Manual Length = 182 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 508 APESTRSSKRTLLRGRESVPPIHEHPAAQ 594 AP++T SS L + ++S+P +EH A+ Sbjct: 128 APQTTASSNTQLTQQQQSLPQTNEHQRAR 156 >SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 527 PVKGLYSEVGSRCRRFTNIP 586 P+ GL+ VGSR R+ + IP Sbjct: 114 PLSGLHQNVGSRTRKSSGIP 133 >SPCC18B5.10c |||TREX complex subunit Tex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 309 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 126 INFIDLRERFLIRLFLAPAKTRMNSLLWS 40 ++FID RER ++ F P +T N WS Sbjct: 135 LSFIDARERRIMETFQQPCET--NECCWS 161 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 25.8 bits (54), Expect = 6.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 563 CRRFTNIPRHNYVYLASILYI 625 C +F +PR NY L S L++ Sbjct: 860 CDQFATVPRENYANLVSQLHV 880 >SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 853 Score = 25.4 bits (53), Expect = 7.9 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 545 SEVGSRCRRFTNIPRHNYVYLASILYISPF*LFCKTNFSFHI-SHRLPFEL 694 SE+ ++ RR +H Y+YLA L+ L C F F++ ++R F L Sbjct: 52 SEIEAKKRRRK---KHRYIYLAVCLFFLASVLSCAIIFRFYLHTNRENFSL 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,652,559 Number of Sequences: 5004 Number of extensions: 52200 Number of successful extensions: 147 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -