BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f08 (251 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75537-5|CAA99837.3| 335|Caenorhabditis elegans Hypothetical pr... 26 3.1 U49829-8|AAV28348.1| 515|Caenorhabditis elegans Hypothetical pr... 26 3.1 U49829-7|AAA93388.3| 513|Caenorhabditis elegans Hypothetical pr... 26 3.1 Z81498-3|CAB04084.3| 260|Caenorhabditis elegans Hypothetical pr... 25 5.4 Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical p... 25 5.4 Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical pr... 25 5.4 EF445112-1|ABQ01579.1| 265|Caenorhabditis elegans scramblase 4 ... 25 5.4 Z68341-3|CAA92766.2| 269|Caenorhabditis elegans Hypothetical pr... 25 7.1 U61952-9|AAB03165.1| 1321|Caenorhabditis elegans Temporarily ass... 25 7.1 U61952-8|AAB03166.1| 1372|Caenorhabditis elegans Temporarily ass... 25 7.1 >Z75537-5|CAA99837.3| 335|Caenorhabditis elegans Hypothetical protein F18E2.4 protein. Length = 335 Score = 26.2 bits (55), Expect = 3.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 126 CVNCGFTLTEI*NRVYALLC 185 C+ CG TL + NRV+ +LC Sbjct: 119 CMACGSTLLLVINRVFDVLC 138 >U49829-8|AAV28348.1| 515|Caenorhabditis elegans Hypothetical protein F27D9.8b protein. Length = 515 Score = 26.2 bits (55), Expect = 3.1 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +2 Query: 71 SSIYFTFINNVSYYD*KTLCELWFYPDRDLKPC-----ICSPLLFLDD 199 S I F +S YD T +W Y RDL+ +C L F DD Sbjct: 416 SGIVFDIKQGISLYDIPTKSYIWQYRFRDLQAVADDGKLCVQLSFNDD 463 >U49829-7|AAA93388.3| 513|Caenorhabditis elegans Hypothetical protein F27D9.8a protein. Length = 513 Score = 26.2 bits (55), Expect = 3.1 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Frame = +2 Query: 71 SSIYFTFINNVSYYD*KTLCELWFYPDRDLKPC-----ICSPLLFLDD 199 S I F +S YD T +W Y RDL+ +C L F DD Sbjct: 416 SGIVFDIKQGISLYDIPTKSYIWQYRFRDLQAVADDGKLCVQLSFNDD 463 >Z81498-3|CAB04084.3| 260|Caenorhabditis elegans Hypothetical protein F11A6.2 protein. Length = 260 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/17 (58%), Positives = 11/17 (64%), Gaps = 3/17 (17%) Frame = +3 Query: 21 CCLWCCACV---QNGCV 62 CC CCACV Q+ CV Sbjct: 107 CCYGCCACVGCCQHDCV 123 >Z46242-15|CAA86337.2| 2507|Caenorhabditis elegans Hypothetical protein F10F2.1 protein. Length = 2507 Score = 25.4 bits (53), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 136 QFTQCFLVVV*NVIDKSKINRRKI 65 Q +CFL+ + N+ +SK NRR I Sbjct: 940 QIKKCFLIDIINLCRESKENRRTI 963 >Z35598-8|CAA84657.2| 2507|Caenorhabditis elegans Hypothetical protein F10F2.1 protein. Length = 2507 Score = 25.4 bits (53), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 136 QFTQCFLVVV*NVIDKSKINRRKI 65 Q +CFL+ + N+ +SK NRR I Sbjct: 940 QIKKCFLIDIINLCRESKENRRTI 963 >EF445112-1|ABQ01579.1| 265|Caenorhabditis elegans scramblase 4 protein. Length = 265 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/17 (58%), Positives = 11/17 (64%), Gaps = 3/17 (17%) Frame = +3 Query: 21 CCLWCCACV---QNGCV 62 CC CCACV Q+ CV Sbjct: 107 CCYGCCACVGCCQHDCV 123 >Z68341-3|CAA92766.2| 269|Caenorhabditis elegans Hypothetical protein F01G4.5 protein. Length = 269 Score = 25.0 bits (52), Expect = 7.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 56 MCFDFSSIYFTFINNVSYYD*KTLCELWFY 145 M +DFS I+F N Y K LC L +Y Sbjct: 131 MVYDFSQIFFLHFNCFDAYATK-LCYLCYY 159 >U61952-9|AAB03165.1| 1321|Caenorhabditis elegans Temporarily assigned gene nameprotein 137, isoform b protein. Length = 1321 Score = 25.0 bits (52), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 24 CLWCCACVQNGCV 62 C+WC CV + C+ Sbjct: 185 CIWCGCCVHDTCI 197 >U61952-8|AAB03166.1| 1372|Caenorhabditis elegans Temporarily assigned gene nameprotein 137, isoform a protein. Length = 1372 Score = 25.0 bits (52), Expect = 7.1 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 24 CLWCCACVQNGCV 62 C+WC CV + C+ Sbjct: 185 CIWCGCCVHDTCI 197 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,195,275 Number of Sequences: 27780 Number of extensions: 64547 Number of successful extensions: 218 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 12,740,198 effective HSP length: 63 effective length of database: 10,990,058 effective search space used: 219801160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -