BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f07 (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 4.3 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 5.7 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 23 5.7 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 23 7.5 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 23 7.5 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 7.5 Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium... 23 10.0 DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium c... 23 10.0 AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel pro... 23 10.0 AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel pro... 23 10.0 AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel pro... 23 10.0 AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel pro... 23 10.0 AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel pro... 23 10.0 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 10.0 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.8 bits (49), Expect = 4.3 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 117 CIESCKTT*DLDECHLINYLTHIKTHNLIDLICYFEYTI 1 C + +TT + C + N+ TH + H I+ C EYT+ Sbjct: 42 CSQCIQTT-NCRWCTMPNF-THPRCHGQIEKYCPEEYTV 78 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 23.4 bits (48), Expect = 5.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 279 AAMVVFCLAAVIFPMGFHVDEIGGQPYQ 362 AA+++ C++ P G + GG+ YQ Sbjct: 12 AALLLVCISLASAPRGTEANIFGGKLYQ 39 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 23.4 bits (48), Expect = 5.7 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 312 IFPMGFHVDEIGGQPYQLPNSHQV--GISYIL 401 ++P + + QPYQLPN + G+ I+ Sbjct: 365 LYPPVASIHRMTSQPYQLPNGEVIPEGVGVII 396 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 23.0 bits (47), Expect = 7.5 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 456 TLSQQKVQISLLSKGREQIICRRFQLDDCLVIDKVVLQSHPRGNPWEI 313 T SQ V I L R RFQ DD +++ + SHP + WE+ Sbjct: 20 TSSQSVVSIVL----RVPFPANRFQPDDIFTMEQFLKISHP-PHYWEL 62 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 23.0 bits (47), Expect = 7.5 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 456 TLSQQKVQISLLSKGREQIICRRFQLDDCLVIDKVVLQSHPRGNPWEI 313 T SQ V I L R RFQ DD +++ + SHP + WE+ Sbjct: 20 TSSQSVVSIVL----RVPFPANRFQPDDIFTMEQFLKISHP-PHYWEL 62 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/23 (43%), Positives = 11/23 (47%), Gaps = 1/23 (4%) Frame = +3 Query: 96 WS-CMTLYNRPQVCFTPDLQPEW 161 WS C L+ R QVC P W Sbjct: 31 WSLCQKLHFRDQVCCVQRSPPHW 53 >Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium channel protein. Length = 136 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 51 HDLPRWNFTDFMHSFMIVFR 70 >DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium channel variant 1 protein. Length = 78 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 5 HDLPRWNFTDFMHSFMIVFR 24 >AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 8 HDLPRWNFTDFMHSFMIVFR 27 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 22.6 bits (46), Expect = 10.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 550 HKLKRIFFANFIHLLMIIIR 491 H L R F +F+H MI+ R Sbjct: 966 HDLPRWNFTDFMHSFMIVFR 985 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 634,180 Number of Sequences: 2352 Number of extensions: 14148 Number of successful extensions: 90 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -