BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov12f07 (601 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC027604-1|AAH27604.1| 91|Homo sapiens chromosome 16 open read... 46 1e-04 AF031174-1|AAC72013.1| 1215|Homo sapiens Ig-like membrane protei... 30 7.1 >BC027604-1|AAH27604.1| 91|Homo sapiens chromosome 16 open reading frame 52 protein. Length = 91 Score = 46.0 bits (104), Expect = 1e-04 Identities = 20/70 (28%), Positives = 28/70 (40%) Frame = +3 Query: 84 LGLMWSCMTLYNRPQVCFTPDLQPEWXXXXXXXXXXXXXXXXXXXXXASSHFDRNVVPYA 263 +GL+ C T++ R + C P L PEW +SH+ R YA Sbjct: 17 VGLVRQCQTIHGRDRTCIPPRLPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYA 76 Query: 264 RWVGFAAMVV 293 RW+ F V Sbjct: 77 RWIAFTGKCV 86 >AF031174-1|AAC72013.1| 1215|Homo sapiens Ig-like membrane protein protein. Length = 1215 Score = 29.9 bits (64), Expect = 7.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 336 PRGNPWEI*LPLSRIQPLLQNQPILHMGP 250 P GNPWE L R+ P+L +L P Sbjct: 1065 PEGNPWEGRLRFQRLSPVLYRLTVLQASP 1093 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,785,139 Number of Sequences: 237096 Number of extensions: 1935030 Number of successful extensions: 2647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2646 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -